ProGP148 (β-1,4-mannanase (G-enzyme))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP148 (β-1,4-mannanase (G-enzyme))
Validation Status Uncharacterized
Organism Information
Organism NameBacillus circulans K-1
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1397
Genome Information
GenBank AB007123
EMBL AB007123
Gene Information
Gene NameG-gene
Protein Information
Protein Nameβ-1,4-mannanase (G-enzyme)
UniProtKB/SwissProt ID O66185
EMBL-CDSBAA25878.1
UniProtKB Sequence >tr|O66185|O66185_BACCI Mannanase OS=Bacillus circulans PE=4 SV=1 MGWFLVILRKWLIAFVAFLLMFSWTGQLTNKAHAASGFYVSGTKLLDATGQPFVMRGVNH AHTWYKDQLSTAIPAIAKTGANTIRIVLANGHKWTLDDVNTVNNILTLCEQNKLIAVLEV HDATGSDSLSDLDNAVNYWIGIKSALIGKEDRVIINIANEWYGTWDGVAWANGYKQAIPK LRNAGLTHTLIVDSAGWGQYPDSVKNYGTEVLNADPLKNTVFSIHMYEYAGGNASTVKSN IDGVLNKNLALIIGEFGGQHTNGDVDEATIMSYSQEKGVGWLAWSWKGNSSDLAYLDMTN DWAGNSLTSFGNTVVNGSNGIKATSVLSGIFGGVTPTSSPTSTPTSTPTSTPTPTPSPTP SPGNNGTILYDFETGTQGWSGNNISGGPWVTNEWKATGAQTLKADVSLQSNSTHSLYITS NQNLSGKSSLKATVKHANWGNIGNGIYAKLYVKTGSGWTWYDSGENLIQSNDGTILTLSL SGISNLSSVKEIGVEFRASSNSSGQSAIYVDSVSLQ
Sequence length 516 AA
Subcellular LocationIntracellular
Function Degrades guar gum which consists of a galactomannosaccharide from the endosperm of guar seeds.
Glycosylation Status
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel, periodic acid-Schiff (PAS) staining
Glycan Information
Glycan Annotation Recombinant G-enzyme (expressed in E. coli) shows GalNAc, Xyl, GlcNAc, Man, Glc, and Gal to account for 1.7%, 14.4%, 6.1%, 3.2%, 54.2%, and 10.4%, respectively, of total monosaccharides. G-enzyme from strain K-1 contains GalNAc, Xyl, GlcNAc, Man, Fuc, and Gal that account for 1.8%, 0.9%, 11.0%, 6.1%, 1.1%, and 79.1%, respectively, of total monosaccharides.
Literature
Year of Identification1998
Year of Identification Month Wise1998.03