ProGP284 (PonA2)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP284 (PonA2)
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Information
GenBank BX842583.1
EMBL BX842583
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene Namepon1 (Rv3682)
NCBI Gene ID 885751
GenBank Gene Sequence NC_000962.2
Protein Information
Protein NamePonA2
UniProtKB/SwissProt ID Q7D529
NCBI RefSeq YP_178005.1
EMBL-CDSCAE55630.1
UniProtKB Sequence >tr|Q7D529|Q7D529_MYCTU Penicillin-binding protein 1 OS=Mycobacterium tuberculosis GN=pon1 PE=4 SV=1 MPERLPAAITVLKLAGCCLLASVVATALTFPFAGGLGLMSNRASEVVANGSAQLLEGQVP AVSTMVDAKGNTIAWLYSQRRFEVPSDKIANTMKLAIVSIEDKRFADHSGVDWKGTLTGL AGYASGDLDTRGGSTLEQQYVKNYQLLVTAQTDAEKRAAVETTPARKLREIRMALTLDKT FTKSEILTRYLNLVSFGNNSFGVQDAAQTYFGINASDLNWQQAALLAGMVQSTSTLNPYT NPDGALARRNVVLDTMIENLPGEAEALRAAKAEPLGVLPQPNELPRGCIAAGDRAFFCDY VQEYLSRAGISKEQVATGGYLIRTTLDPEVQAPVKAAIDKYASPNLAGISSVMSVIKPGK DAHKVLAMASNRKYGLDLEAGETMRPQPFSLVGDGAGSIFKIFTTAAALDMGMGINAQLD VPPRFQAKGLGSGGAKGCPKETWCVVNAGNYRGSMNVTDALATSPNTAFAKLISQVGVGR AVDMAIKLGLRSYANPGTARDYNPDSNESLADFVKRQNLGSFTLGPIELNALELSNVAAT LASGGVWCPPNPIDQLIDRNGNEVAVTTETCDQVVPAGLANTLANAMSKDAVGSGTAAGS AGAAGWDLPMSGKTGTTEAHRSAGFVGFTNRYAAANYIYDDSSSPTDLCSGPLRHCGSGD LYGGNEPSRTWFAAMKPIANNFGEVQLPPTDPRYVDGAPGSRVPSVAGLDVDAARQRLKD AGFQVADQTNSVNSSAKYGEVVGTSPSGQTIPGSIVTIQISNGIPPAPPPPPLPEDGGPP PPVGSQVVEIPGLPPITIPLLAPPPPAPPP
Sequence length 810 AA
Subcellular LocationMembrane
Function Penicillin-binding protein with transglycosylase and transpeptidase activities.
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzález-Zamorano M, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009, 8(2), 721-33. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.