ProGP4 (F-pilin)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP4 (F-pilin)
Validation Status Uncharacterized
Organism Information
Organism NameEscherichia coli K12
Domain Bacteria
Classification Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 83333
Genome Information
GenBank AP001918.1
EMBL AP001918.1
Organism Additional Information Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea andhemorrhagic colitis. There are a myriad of serotypes of pathogenic E. coli. Adhesion to the host cells is an important step in its pathogenesis. However, most strains are harmless and normal flora residing in the gut.
Gene Information
Gene NametraA (ECOK12F074)
NCBI Gene ID 1263548
GenBank Gene Sequence M11322
Protein Information
Protein NameF-pilin
UniProtKB/SwissProt ID P04737
NCBI RefSeq NP_061453.1
EMBL-CDSAAC44177.1
UniProtKB Sequence >sp|P04737|PIL1_ECOLI Pilin OS=Escherichia coli (strain K12) OX=83333 GN=traA PE=1 SV=1 MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLM ASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVG L
Sequence length 121 AA
Subcellular LocationSurface
Function Major protein of F pilus (sex pili).
Protein Structure
PDB ID 5LER, 5LFB
Glycan Information
Glycan Annotation One covalently bound glucose molecule per pilin subunit.
Literature
Year of Identification1975
Year of Identification Month Wise1975.1
ReferenceTomoeda, M., Inuzuka, M. and Date, T. (1975) Bacterial sex pili. Prog Biophys Mol Biol, 30, 23-56. [PubMed: 1101296]
Author Tomoeda, M., Inuzuka, M. Date, T.
Research GroupDepartment of Chemistry, Faculty of Pharmaceutical Sciences, Kanazawa University, Kanazawa, Japan
Corresponding Author Date, T.
ContactDepartment ol Chemistry. Faculty of Pharmaceutical Sciences, Kanazawa University, Kanazawa, Japan
ReferenceBrinton CC Jr. (1971) The properties of sex pili, the viral nature of "conjugal" genetic transfer systems, and some possible approaches to the control of bacterial drug resistance. CRC Crit Rev Microbiol., 1, 105-60. [PubMed: 4114944]
AuthorBrinton CC Jr
Corresponding Author Brinton CC Jr