ProGP41 (HPI (hexagonally packed intermediate) lay

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP41 (HPI (hexagonally packed intermediate) lay
Validation Status Uncharacterized
Organism Information
Organism NameDeinococcus radiodurans
Domain Bacteria
Classification Family: Deinococcaceae
Order: Deinococcales
Class: Deinococci
Division or phylum: "Deinococcus-Thermus"
Taxonomic ID (NCBI) 1299
Genome Information
GenBank M17895
EMBL M17895
Gene Information
Gene Namehpi
Protein Information
Protein NameHPI ( hexagonally packed intermediate) layer polypepetide
UniProtKB/SwissProt ID P13126
EMBL-CDSAAA23335.1
UniProtKB Sequence >sp|P13126|HPI2_DEIRA Hexagonally packed intermediate-layer surface protein OS=Deinococcus radiodurans GN=hpi PE=1 SV=1 MKKNIALMALTGVLTLASCGQNGNTPTADTTAPTVSLSVNNANLPSGVGSVVLSGTVNEA STVVVKNNAGTTVCTVEVAASGTFTCPATTIAGNTSTTSTSTSYTATATDAAKNVGTSSV VTVNVAGVSNPAPTTAVLTIDLAGVSSAPITIKDANGNVVQGYDNVTVNDNATITVARGV YTVTAGNVSGFNGPTTNFRVDLSGGNQTVTLNYTQAGTTTPTPVGSINILTPAVGTSVTG GSTVRVTFDKANEVQCMVGGAAAVTAQVDSTSGYCDVVVPNSTGNVVITVMGKGVNGQTV TATRNISVTQAAVSYGVVTPAGDQELTLTSEGIVRDADSGWRRLGQGVSTPSDPNLNLDI YIKGTVNFSVNAPAGQKVELFLARTTGSDVPTNDDIQAGDVLRSVASTSGTETFSLDSRR LAEFDGVRKWIVVRINGTQVTYQPVIADNKGPQQPDPELNGVQNAYSNILNNYNNSGLTY VRGPVNVFTSNPSLQDREFGQAPVGSSFVQRRPAGFESIRYYLVPESAFNNKALQESDEM LRAKAVKSVATVVSAPVLEPGTVKATSFSRVIGSGATSTVAPKALDNVTYRVYAISRDQV GNETASATYDLVRFDNVGPTITGSVIRDTSDLPFPSQEPERCLSDIATISLGGIADNVGG VGLNPGQGLTFTLGGRQIQAGQFDTNQLADPEYTIGFNSLTDALGNPVVTAPTNAKVYID NTDPTVNFNRAVMQGTYASGGRVSVESDASDGGCGVYETRLFWDTANGVVDDATTTPAIG HPVQFARQRVTDGAKADSLNAGWNALQLPNGAGAVYLRSLVVDRAGNATISTTSIVVNAK ITNQARPLLGGFDAFKRNASAQFVGDDNVIAGVNGTAATPNVTGNSALDNILSLDSVGTL TTNAYLPRGATETAITEKIRNVGAYGRFDATQWNLIRDYQLNTDPTLRSAYVNAGNLANQ RGNNWRIRTPWVELGSSDTANTQQKFDFNSDLLNDFYYGRTFGNNHSVNLFSYDQFNGVV SDTAGAYSFYGETVRK
Sequence length 1036 AA
Subcellular LocationSurface (secreted)
Function The function(s) of bacterial S layers is still somewhat enigmatic. A primordial function of perpetual importance is shape maintenance and possibly shape determination.
Glycosylation Status
Technique(s) used for Glycosylation DetectionDetection of sugars by GC-MS technique after their conversion into alditol acetates.
Glycan Information
Glycan Annotation 6 tightly bound sugar residues per polypeptide chain.
Literature
Year of Identification1987
Year of Identification Month Wise1987.02