ProGP450 (AtaC)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP450 (AtaC)
Validation Status Uncharacterized
Organism Information
Organism NameActinobacillus pleuropneumoniae
Domain Bacteria
Classification Family: Pasteurellaceae
Order: Pasteurellales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 715
Genome Information
GenBank M65808
EMBL M65808
Protein Information
Protein NameAtaC
UniProtKB/SwissProt ID A7UDC6
EMBL-CDSABS89211.1
UniProtKB Sequence >tr|A7UDC6|A7UDC6_ACTPL AtaC (Fragment) OS=Actinobacillus pleuropneumoniae GN=ataC PE=4 SV=1 VAKGTEDSDAVNYSQLKEYVGNNSSYTWNISDNAEGTNSATVSNKDTVAVQGSVKKDEST TKSGIVTKLDGKNITVDLSEKAKQELENGQKHSSVNGDTNVLVEVNKAPNAEGGKQYDVK LADKIVIGQGDNSVTIDGTSGTVSGLNNLTWDPSATYEGGKAATQEQLKLVSDEVQKGWN VQTNNDTAQKVAPGE
Sequence length 195 AA
Function Autotransporter adhesins protein family
Glycosylation Status
Glycosylation Type N- (Asn) linked
Technique(s) used for Glycosylation DetectionLC-ESI-MS/MS
Glycan Information
Glycan Annotation Hexose and dihexose
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT41 (NGT)
Literature
ReferenceNaegeli A, Neupert C, Fan YY, Lin CW, Poljak K, Papini AM, Schwarz F, Aebi M. (2014) Molecular analysis of an alternative N-glycosylation machinery by functional transfer from Actinobacillus pleuropneumoniae to Escherichia coli.J Biol Chem., 289(4):2170-9. [PubMed: 24275653]
AuthorNaegeli A, Neupert C, Fan YY, Lin CW, Poljak K, Papini AM, Schwarz F, Aebi M
Research GroupInstitute of Microbiology, Swiss Federal Institute of Technology, ETH Zurich, CH-8093 Zurich, Switzerland
Corresponding Author Aebi M
ContactInstitute of Microbiology, Swiss Federal Institute of Technology, ETH Zurich, CH-8093 Zurich, Switzerland