ProGP458 (ThuA)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP458 (ThuA)
Validation Status Characterized
Organism Information
Organism NameBacillus thuringiensis serovar andalousiensis BGSC 4AW1
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1428
Genome Information
GenBank NZ_MSFC01000028.1.
EMBL CP012099
Gene Information
Gene NamethuA
Protein Information
Protein NameThuA
UniProtKB/SwissProt ID C3GCL2
NCBI RefSeq WP_000661240.1
UniProtKB Sequence >tr|C3GCL2|C3GCL2_BACTU Uncharacterized protein OS=Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 GN=bthur0009_56250 PE=4 SV=1 MKELIKELNLEELETFEGGYDGVNYMHQHDGGGAGGGSGIGTAQCAYFKALCYSGGSEWL GGYGGCGSTQNNCELARKYC
Sequence length 80 AA
Subcellular LocationExtracellular
Glycosylation Status
Glycosylation Type O- (Ser) and S- (Cys) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS19 and C28
Glycosite(s) Annotated Protein Sequence ">tr|C3GCL2|C3GCL2_BACTU Uncharacterized protein OS=Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 GN=bthur0009_56250 PE=4 SV=1 MKELIKELNLEELETFEGGYDGVNYMHQHDGGGAGGGSGIGTAQCAYFKALCYSGGS*(19)EWL GGYGGC*(28)GSTQNNCELARKYC"
Sequence Around Glycosites (21 AA) YFKALCYSGGSEWLGGYGGCG
Technique(s) used for Glycosylated Residue(s) Detection MALDI-TOF MS
Protein Glycosylation- Implication All thurandacin analogs with different sugars displayed similar growth inhibitory activity, as indicated by agar diffusion assay. Thus, the stereochemistry of the hexose does not appear to be critical for bioactivity.
Glycan Information
Glycan Annotation Monosaccharide ( GlcNAc, Gal, Man)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT65 (ThuS)
ReferenceWang H, Oman TJ, Zhang R, Garcia De Gonzalo CV, Zhang Q, van der Donk WA. (2014) The glycosyltransferase involved in thurandacin biosynthesis catalyzes both O- and S-glycosylation. J Am Chem Soc., 136(1):84-7. [PubMed: 24325644]
AuthorWang H, Oman TJ, Zhang R, Garcia De Gonzalo CV, Zhang Q, van der Donk WA.
Research GroupHoward Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign , 600 South Mathews Avenue, Urbana, Illinois 61801, United States.
Corresponding Author van der Donk WA.
ContactHoward Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign , 600 South Mathews Avenue, Urbana, Illinois 61801, United States.