ProGP492 (Type IV Pilin)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP492 (Type IV Pilin)
Validation Status Uncharacterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Information
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Burkholderia cenocepacia causes opportunistic infections in plants, insects, animals and humans. It acts as a health threat to cystic fibrosis patients, causing lethal necrotizing pneumonia in some cases.
Gene Information
Gene Namebcal0959
Protein Information
Protein NameType IV Pilin
UniProtKB/SwissProt ID B4EBY9
NCBI RefSeq WP_006486698.1
EMBL-CDSCAR51266.1
UniProtKB Sequence >tr|B4EBY9|B4EBY9_BURCJ Putative type IV pilin protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pilA PE=4 SV=1 MFEAFSVSLFRRVAADLRRANRPSPRWRPAGFTLIELMIVLAIVGVVAAYAIPAYQDYLA RSRVGEGLALASSARLAVADNAASGTSLDGGYSPPAATRNVESVAIDGVTGQITVAFTTR VAAAGTNTLVLVPSAPDKADTPTARVPLKKGTIQAGTIAWECFAAGKDASSLPAPGAGPL PSNAATLPAKYAPAECRA
Sequence length 198 AA
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
OST ProGT IDProGT71 (PglLBc)
Literature
ReferenceLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. (2014) A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence. Mol Microbiol., 92(1):116-37. [PubMed: 24673753]
AuthorLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ.
Research GroupDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,
Corresponding Author Dennis JJ.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,