ProGP546 (Pilin A2)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP546 (Pilin A2)
Validation Status Characterized
Organism Information
Organism NameHaloferax volcanii H53
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 309800
Genome Information
GenBank CP001956.1
EMBL CP001956.1
Gene Information
Gene NamepilA2 (HVO_2062)
NCBI Gene ID 8923886
GenBank Gene Sequence NC_013967.1
Protein Information
Protein NamePilin A2
UniProtKB/SwissProt ID D4GU75
NCBI RefSeq WP_004041947.1
EMBL-CDSADE03103.1
UniProtKB Sequence >tr|D4GU75|D4GU75_HALVD Pilin PilA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=pilA2 PE=4 SV=1 MQLTTLFNDDSAVSPVIGVILMVAITVILAAVIGTFVLGLGDQVSETSPQASFDFDYTNT SGNLTITHESGTSIDADSVSISGPVGDDGKTWADIDGSATEITAGSSITVTANGSSFDSG ETVRVIWTSDSGSSSSTLQSWTYNG
Sequence length 145 AA
Function Structural subunit of type IV pili involved in surface adhesion
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN59, N63 and N113
Glycosite(s) Annotated Protein Sequence >tr|D4GU75|D4GU75_HALVD Pilin PilA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=pilA2 PE=4 SV=1 MQLTTLFNDDSAVSPVIGVILMVAITVILAAVIGTFVLGLGDQVSETSPQASFDFDYTN*(59)T SGN*(63)LTITHESGTSIDADSVSISGPVGDDGKTWADIDGSATEITAGSSITVTAN*(113)GSSFDSG ETVRVIWTSDSGSSSSTLQSWTYNG
Sequence Around Glycosites (21 AA) PQASFDFDYTNTSGNLTITHE
FDFDYTNTSGNLTITHESGTS
TAGSSITVTANGSSFDSGETV
Technique(s) used for Glycosylation DetectionAberrant migration on lithium dodecyl sulfate (LDS)-PAGE as detected through western blotting
Technique(s) used for Glycosylated Residue(s) Detection MS using HCD fragmentation
Protein Glycosylation- Implication N-glycosylation may regulate the transition from planktonic cell to biofilm formation under stress conditions.
Glycan Information
Glycan Annotation One tetra- and one pentasaccharide on its two glycosites. The pentasaccharide is composed of a hexose, two hexuronic acids, a methylated hexuronic acid, and a mannose.
Technique(s) used for Glycan Identification MS using IS (in source)-CID and HCD fragmentation
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameAglB
Additional CommentPilin expression in ΔpilA[1–6]ΔaglB stimulates microcolony formation.
Literature
Year of Identification2016
Year of Identification Month Wise2016.05
Year of Validation 2016
ReferenceEsquivel RN, Schulze S, Xu R, Hippler M, Pohlschroder M. (2016) Identification of Haloferax volcanii Pilin N-Glycans with Diverse Roles in Pilus Biosynthesis, Adhesion, and Microcolony Formation. J Biol Chem., 291(20), 10602-14. [PubMed: 26966177]
AuthorEsquivel RN, Schulze S, Xu R, Hippler M, Pohlschroder M.
Research Group1 Department of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104. 2 Institute of Plant Biology and Biotechnology, University of Münster, Münster 48143, Germany. 3 Department of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104.
Corresponding Author Pohlschroder M.
ContactDepartment of Biology, University of Pennsylvania, Philadelphia, Pennsylvania 19104.