Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT59.14 (WsfG)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT59.14 (WsfG)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene NamewsfG 
NCBI Reference SequenceHM011508
Protein information
Protein NameWsfG 
UniProtKB/ SwissProt IDD6QW70
UniProtKB Sequence>tr|D6QW70|D6QW70_PAEAL Putative family 2 glycosyltransferase OS=Paenibacillus alvei GN=wsfG PE=4 SV=1 MIDLSVIIVNYNTKQLTLNCLSSVYQSITNYQIEVILIDNGSHDNSAEAIADRYPQVRLI SNTNNLGFSKANNQGMRIAEGRYVLLLNSDTVIEPDTLDVMIGFMDDHPNVGASGCKVVL PDGSLDKACRRGFPTPSATFFYVSRLSKLFPKSPRINAYHREDLNPDEEFPIDCLIGAFM MVRRGAIEQVGMLDENFFMYGEDVDWCYRIKQAGWVNYYYPKTQIIHYKRASSRNKPFKI TYEFHRAFFVLYNKHFCKKYPFWVNGLMYAGMGLKMSVALLLNALAKGITAIRQNTKSN
EMBL CDSADG29299.1.
Sequence length299 AA
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Litrature
Year Of Validation2010 
Reference Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schffer, C. (2010). Protein tyrosine O-glycosylationa rather unexplored prokaryotic glycosylation system.Glycobiology,20(6), 787-798.

Authors Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schffer, C.
Research groupsDepartment of NanoBiotechnology, ViennaInstitute of BioTechnology, Universitt fr Bodenkultur Wien, A-1190 Vienna,Austria.
Corresponding Author Schffer, C.
ContactsDepartment of NanoBiotechnology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.