Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT59.4 (Wzt)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT59.4 (Wzt)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene Namewzt 
NCBI Reference SequenceHM011508
Protein information
Protein NameWzt 
UniProtKB/ SwissProt IDD6QW59
UniProtKB Sequence>tr|D6QW59|D6QW59_PAEAL Putative ATP-binding protein OS=Paenibacillus alvei GN=wzt PE=4 SV=1 MGKSVLEVKNVTKIYKIYDNPSHRIKEAFNLTKKKYHKEFRAVDNVSFSVNKGQIVGILG KNGSGKSTLLKMVTGVITPTEGEIIRNGKIAALLELGAGFNPNLTGIENIYLNGTLMGYN KEEMDNKINDIISFADIGEFIHQPVKMYSSGMFARLAFSVAINVEPEILIVDEALSVGDI YFQAKCVTKMKELSQTCTILFVSHSMDTIKSFCDTAILLNEGKMIHYGPVKKVVQVYENM MNQEIADMKSVQSLDKFVKGGISDQNNTSLLYQEDNNFTKMANEFRSGTGEARFIRADLL VNGKKTNTLSFGDKVTLRLVAQYYMDVDTEGTIGYMIRNHNGVDIFGMNIYNKARLLPPM RKNEILEVKFQFVNLLSESGKYTISIGLKPKPFEPLYFDSISIAAVFEVRKIENNYVPGL IFVDNEIESQVINI
EMBL CDSADG29288.1.
Sequence length434 AA
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Additional Information1) An ATP-binding site and an ATP transporter signature motif identified in the putative translation product of wzt indicate its involvement in the transport of sugars across the cytoplasmic membrane. 
Litrature
Year Of Validation2010 
Reference Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C. (2010). Protein tyrosine O-glycosylation—a rather unexplored prokaryotic glycosylation system. Glycobiology, 20(6), 787-798.

Authors Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C.
Research groupsDepartment of NanoBiotechnology, ViennaInstitute of BioTechnology, Universität für Bodenkultur Wien, A-1190 Vienna,Austria.
Corresponding Author Schäffer, C.
ContactsDepartment of NanoBiotechnology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.