Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT75.3 (GlyB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT75.3 (GlyB)
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene NameglyB (SP_1770) 
Protein information
Protein NameGlyB 
UniProtKB/ SwissProt IDA0A0H2URA3
NCBI Ref SeqWP_001093470.1
UniProtKB Sequence>tr|A0A0H2URA3|A0A0H2URA3_STRPN Glycosyl transferase, family 8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1770 PE=4 SV=1 MNTKSIVFNADNDYVDKLETAIKSICCYNNCLKFYVFNDDIASEWFLMMNKRLKTIQSEI VNVKIVDHVLKKFHLPLKNLSYATFFRYFIPNFVKESRALYLDSDIIVTGSLDYLFDIEL DGYALAAVEDSFGDVPSTNFNSGMLLVNVDTWRDEDACSKLLELTNQYHETAYGDQGILN MLFHDRWKRLDRNFNFMVGMDSVAHIEGNHKWYEISELKNGDLPSVIHYTGVKPWEIISN NRFREVWWFYNLLEWSDILLRKDIISRSFEELVYSPKAHTAIFTASCEMEHVEYLIENLP EVHFSILAHTYFASSVVALLRYSNVTIYPCFSPFDYRKILDNLDFYLDINHYKEVDNIVS VVQQLSKPIFTFENTSHDIGNQTNIFSSTEPNKMVEAIRQFIGE
EMBL CDSAAK75844
Sequence length404 AA
Glycosylation Information
Experimental ValidationIn vivo and In vitro
Litrature
Year Of Validation2017 
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP.The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China
Corresponding AuthorZhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.