ProGP114

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP114
Validation Status Characterized
Organism Information
Organism NameFlavobacterium meningosepticum (Elizabethkingia meningoseptica)
Domain Bacteria
Classification Family: Flavobacteriaceae
Order: "Flavobacteriales"
Class: Flavobacteria
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 238
Genome Sequence(s)
GenBank L06331
EMBL L06331
Gene Information
Gene NameendO F2
Protein Information
Protein NameEndo-β-N-acetylglucosaminidase F2
UniProtKB/SwissProt ID P36912
EMBL-CDSAAA24923.1
UniProtKB Sequence >sp|P36912|EBA2_FLAME Endo-beta-N-acetylglucosaminidase F2 OS=Flavobacterium meningosepticum GN=endOF2 PE=1 SV=1 MKTANFSFALCLSVVIMLFIKCTRSEQDLSVTKDAIAQKSGVTVSAVNLSNLIAYKNSDH QISAGYYRTWRDSATASGNLPSMRWLPDSLDMVMVFPDYTPPENAYWNTLKTNYVPYLHK RGTKVIITLGDLNSATTTGGQDSIGYSSWAKGIYDKWVGEYNLDGIDIDIESSPSGATLT KFVAATKALSKYFGPKSGTGKTFVYDTNQNPTNFFIQTAPRYNYVFLQAYGRSTTNLTTV SGLYAPYISMKQFLPGFSFYEENGYPGNYWNDVRYPQNGTGRAYDYARWQPATGKKGGVF SYAIERDAPLTSSNDNTLRAPNFRVTKDLIKIMNP
Sequence length 335 AA
Subcellular LocationPeriplasm (secreted)
Function Endohydrolysis of the di-N-acetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins. Complex biantennary glycans are the preferred substrates. EC= 3.2.1.96.
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-45) S73, S89, S143
Experimentally Validated Glycosite(s ) in Mature ProteinS28, S44, S98
Glycosite(s) Annotated Protein Sequence >sp|P36912|EBA2_FLAME Endo-beta-N-acetylglucosaminidase F2 OS=Flavobacterium meningosepticum GN=endOF2 PE=1 SV=1 MKTANFSFALCLSVVIMLFIKCTRSEQDLSVTKDAIAQKSGVTVSAVNLSNLIAYKNSDH QISAGYYRTWRDS*(73)ATASGNLPSMRWLPDS*(89)LDMVMVFPDTPPENAYWNTLKTNYVPYLHK RGTKVIITLGDLNSATTTGGQDS*(143)IGYSSWAKGIYDKWVGEYNLDGIDIDIESSPSGATLT KFVAATKALSKYFGPKSGTGKTFVYDTNQNPTNFFIQTAPRYNYVFLQAYGRSTTNLTTV SGLYAPYISMKQFLPGFSFYEENGYPGNYWNDVRYPQNGTGRAYDYARWQPATGKKGGVF SYAIERDAPLTSSNDNTLRAPNFRVTKDLIKIMNP
Sequence Around Glycosites (21 AA) SAGYYRTWRDSATASGNLPSM
NLPSMRWLPDSLDMVMVFPDY
NSATTTGGQDSIGYSSWAKGI
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel and phenol-sulfuric acid assay
Technique(s) used for Glycosylated Residue(s) Detection Edman degradation and collision activated dissociation (CAD) mass spectrometry
Protein Glycosylation- Implication Glycosylation may contribute towards protein stability
Glycan Information
Glycan Annotation Linkage: Man- Ser.
Branched acidic, heptasaccharide (1244 Da) containing 3 different uronyl analogs (uronic acid derivatives), a methylated Rham and Man, a Glc, and a reducing terminal Man. Only pyranose ring forms were detected [(2-OMe)Man1-4GlcNAcU1-4GlcU1-4Glc1-4(2-OMe)GlcU-4[(2-OMe)Rham1-2]Man].
BCSDB ID137520
Technique(s) used for Glycan Identification ESI-MS (electrospray ionization mass spectrometry), CID (collision-induced dissociation), and a combination of isotopic labeling, composition and methylation analysis.
Literature
Year of Identification1995
Year of Identification Month Wise1995.06.02
Year of Validation 1995
ReferencePlummer, T.H., Jr., Tarentino, A.L. and Hauer, C.R. (1995) Novel, specific O-glycosylation of secreted Flavobacterium meningosepticum proteins. Asp-Ser and Asp-Thr-Thr consensus sites. J Biol Chem, 270, 13192-13196. [PubMed: 7768916]
Author Plummer, T.H., Jr., Tarentino, A.L. and Hauer, C.R.
Research GroupDivision of Molecular Medicine, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509, USA.
Corresponding Author Hauer, C.R.
ContactDivision of Molecular Medicine, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509, USA.
ReferenceReinhold, B.B., Hauer, C.R., Plummer, T.H. and Reinhold, V.N. (1995) Detailed structural analysis of a novel, specific O-linked glycan from the prokaryote Flavobacterium meningosepticum. J Biol Chem, 270, 13197-13203. [PubMed: 7768917]
Author Reinhold, B.B., Hauer, C.R., Plummer, T.H. Reinhold, V.N.
Research GroupDepartment of Nutrition, Harvard University School of Public Health, Boston, Massachusetts 02115, USA.
Corresponding Author Reinhold, V.N.
ContactDepartment of Nutrition, Harvard University School of Public Health, Boston, Massachusetts 02115, USA.
ReferenceTarentino, A.L., Quinones, G., Changchien, L.M. and Plummer, T.H., Jr. (1993) Multiple endoglycosidase F activities expressed by Flavobacterium meningosepticum endoglycosidases F2 and F3. Molecular cloning, primary sequence, and enzyme expression. J Biol Chem, 268, 9702-9708. [PubMed: 8486657]
Author Tarentino, A.L., Quinones, G., Changchien, L.M. Plummer, T.H., Jr.
Research GroupDivision of Clinical Sciences, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509.
ContactDivision of Clinical Sciences, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509.