ProGP116

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP116
Validation Status Characterized
Organism Information
Organism NameFlavobacterium meningosepticum (Elizabethkingia meningoseptica)
Domain Bacteria
Classification Family: Flavobacteriaceae
Order: "Flavobacteriales"
Class: Flavobacteria
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 238
Genome Sequence(s)
GenBank L06332
EMBL L06332
Gene Information
Gene NameendOF3
Protein Information
Protein NameEndo-β-N-acetylglucosaminidase F3
UniProtKB/SwissProt ID P36913
EMBL-CDSAAA24924.1
UniProtKB Sequence >sp|P36913|EBA3_FLAME Endo-beta-N-acetylglucosaminidase F3 OS=Flavobacterium meningosepticum GN=endOF3 PE=1 SV=1 MKKIFFAQCSILLLMLGSCSKMTEDMTPESVNKEASVKSATALAGSNGVCIAYYITDGRN PTFKLKDIPDKVDMVILFGLKYWSLQDTTKLPGGTGMMGSFKSYKDLDTQIRSLQSRGIK VLQNIDDDVSWQSSKPGGFASAAAYGDAIKSIVIDKWKLDGISLDIEHSGAKPNPIPTFP GYAATGYNGWYSGSMAATPAFLNVISELTKYFGTTAPNNKQLQIASGIDVYAWNKIMENF RNNFNYIQLQSYGANVSRTQLMMNYATGTNKIPASKMVFGAYAEGGTNQANDVEVAKWTP TQGAKGGMMIYTYNSNVSYANAVRDAVKN
Sequence length 329 AA
Subcellular LocationPeriplasm (secreted)
Function Endohydrolysis of the di-N-acetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins. Hydrolyzes bi- and triantennary glycans. The presence of a core-bound fucose greatly augments endo F3 activity on biantennary and, presumably, triantennary oligosaccharides. EC= 3.2.1.96.
Protein Structure
PDB ID 1EOK, 1EOM
Glycosylation Status
Glycosylation Type O- (Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-39) T88
Experimentally Validated Glycosite(s ) in Mature ProteinT49
Glycosite(s) Annotated Protein Sequence >sp|P36913|EBA3_FLAME Endo-beta-N-acetylglucosaminidase F3 OS=Flavobacterium meningosepticum GN=endOF3 PE=1 SV=1 MKKIFFAQCSILLLMLGSCSKMTEDMTPESVNKEASVKSATALAGSNGVCIAYYITDGRN PTFKLKDIPDKVDMVILFGLKYWSLQDT*(88)TKLPGGTGMMGSFKSYKDLDTQIRSLQSRGIK VLQNIDDDVSWQSSKPGGFASAAAYGDAIKSIVIDKWKLDGISLDIEHSGAKPNPIPTFP GYAATGYNGWYSGSMAATPAFLNVISELTKYFGTTAPNNKQLQIASGIDVYAWNKIMENF RNNFNYIQLQSYGANVSRTQLMMNYATGTNKIPASKMVFGAYAEGGTNQANDVEVAKWTP TQGAKGGMMIYTYNSNVSYANAVRDAVKN
Sequence Around Glycosites (21 AA) FGLKYWSLQDTTKLPGGTGMM
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel and TFA (trifluoroacetic acid) hydrolysis of intact glycopeptide followed by HPAEC chromatography on a PA-1 column
Technique(s) used for Glycosylated Residue(s) Detection Edman degradation and collision activated dissociation (CAD) mass spectrometry
Protein Glycosylation- Implication Glycosylation may contribute towards protein stability
Glycan Information
Glycan Annotation Linkage: Man- Thr.
Branched, acidic, heptasaccharide (1244 Da) containing 3 different uronyl analogs, a methylated Rham and Man, a Glc, and a reducing terminal Man. Only pyranose ring forms were detected [(2-OMe)Man1-4GlcNAcU1-4GlcU1-4Glc1-4(2-OMe)GlcU-4[(2-OMe)Rham1-2]Man].
BCSDB ID137520
Technique(s) used for Glycan Identification ESI-MS (electrospray ionization mass spectrometry), CID (collision-induced dissociation), and a combination of isotopic labeling, composition and methylation analysis.
Literature
Year of Identification1995
Year of Identification Month Wise1995.06.02
Year of Validation 1995
ReferenceWaddling, C.A., Plummer, T.H., Jr., Tarentino, A.L. and Van Roey, P. (2000) Structural basis for the substrate specificity of endo-beta-N-acetylglucosaminidase F(3). Biochemistry, 39, 7878-7885. [PubMed: 10891067]
AuthorWaddling, C.A., Plummer, T.H., Jr., Tarentino, A.L. and Van Roey, P.
Research GroupDivision of Molecular Medicine, Wadsworth Center, New York State Department of Health, Albany, New York 12201, USA.
Corresponding Author Van Roey, P.
ContactDivision of Molecular Medicine, Wadsworth Center, New York State Department of Health, Albany, New York 12201, USA.
ReferencePlummer, T.H., Jr., Tarentino, A.L. and Hauer, C.R. (1995) Novel, specific O-glycosylation of secreted Flavobacterium meningosepticum proteins. Asp-Ser and Asp-Thr-Thr consensus sites. J Biol Chem, 270, 13192-13196. [PubMed: 7768916]
Author Plummer, T.H., Jr., Tarentino, A.L. Hauer, C.R.
Research GroupDivision of Molecular Medicine, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509, USA.
Corresponding Author Hauer, C.R.
ContactDivision of Molecular Medicine, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509, USA.
Reference Plummer, T.H., Jr., Tarentino, A.L. and Hauer, C.R. (1995) Novel, specific O-glycosylation of secreted Flavobacterium meningosepticum proteins. Asp-Ser and Asp-Thr-Thr consensus sites. J Biol Chem, 270, 13192-13196. [PubMed: 7768916]
Author Plummer, T.H., Jr., Tarentino, A.L. Hauer, C.R.
Research GroupDivision of Molecular Medicine, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509, USA.
Corresponding Author Hauer, C.R.
ContactDivision of Molecular Medicine, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509, USA.
Reference Reinhold, B.B., Hauer, C.R., Plummer, T.H. and Reinhold, V.N. (1995) Detailed structural analysis of a novel, specific O-linked glycan from the prokaryote Flavobacterium meningosepticum. J Biol Chem, 270, 13197-13203. [PubMed: 7768917]
Author Reinhold, B.B., Hauer, C.R., Plummer, T.H. Reinhold, V.N.
Research GroupDepartment of Nutrition, Harvard University School of Public Health, Boston, Massachusetts 02115, USA.
ContactDepartment of Nutrition, Harvard University School of Public Health, Boston, Massachusetts 02115, USA.
Reference Tarentino, A.L., Quinones, G., Changchien, L.M. and Plummer, T.H., Jr. (1993) Multiple endoglycosidase F activities expressed by Flavobacterium meningosepticum endoglycosidases F2 and F3. Molecular cloning, primary sequence, and enzyme expression. J Biol Chem, 268, 9702-9708. [PubMed: 8486657]
Author Tarentino, A.L., Quinones, G., Changchien, L.M. Plummer, T.H., Jr.
Research GroupDivision of Clinical Sciences, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509.
Corresponding Author Plummer, T.H., Jr
ContactDivision of Clinical Sciences, Wadsworth Center for Laboratories and Research, New York State Department of Health, Albany 12201-0509.