ProGP121

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP121
Validation Status Characterized
Organism Information
Organism NameAneurinibacillus thermoaerophilus DSM 10155
Domain Bacteria
Classification Family: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 143495
Genome Sequence(s)
GenBank AY395579
EMBL AY395579
Gene Information
Gene Namesat B
Protein Information
Protein NameSurface-layer glycoprotein Sat B
UniProtKB/SwissProt ID Q6TL21
EMBL-CDSAAS44592.1
UniProtKB Sequence >tr|Q6TL21|Q6TL21_ANETH Surface-layer glycoprotein SatB OS=Aneurinibacillus thermoaerophilus GN=satB PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANITNLVNKVLNVKSNYDGEQSASHTLTVKE DDIAFDQTSGETFRVVLPSGVKWKTAPANTPTAKFDLRSDQVLEVTVKGTNTIADDEQVS IPLNFKVDGATGELKLKVESMDSTITSGEYVFAIVGSGSTTAAVDNVKNIGKSGKAGTIR VEETAIGAVADGRNHKVKLKLPSNFRWVTTGTDKTEISTSGGFTSASIVTGESNDNVLVL DVATATGQGRGVLYVTPYIKADKDASYGDVSVNIRGPDFSDSDVVVAKYGDWGATIKVEK VEEVLAGKYDENTRTAKITIEESVPGSFVKGRDIDVELPSWVKVTDIKEFTTSGFTTGAP TSGSVDIDGTDNKISIPLGETGGSSTAKIEFKLELSVQADKTGDIEAVISGGGVAEQKAV IAKAVAPVSVALDGEASKVKIGAQAQDAPNIIITELKKGAIEKTTENGSTTNGTIEVKLP DGVKFASVPKVEVVEGDGTIDVDNVRRINNDNVLTIPVKGESVSKPMKIKLSNVKLTVDR TVPEGDIELKVGGNAIVENYKSGKGWLKGNKQNGSSDALDAGEFNTEHAAKVVVAKTVTP APTDTTATNIVFKLNSKTYTVDGKEFEMDAAPLVGWDRAYLPVRFAANALNVSDDQIVWD DKTSTFTIFKGDRVISGKVGDKFLTVNGAKVPMDVPVWRNKEKTNNRVMVPIRYLANALN AEIEWNKETSEITIQAKK
Sequence length 738 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT471 and/or S69
Experimentally Validated Glycosite(s ) in Mature ProteinT471 and /or S69
Glycosite(s) Annotated Protein Sequence >tr|Q6TL21|Q6TL21_ANETH Surface-layer glycoprotein SatB OS=Aneurinibacillus thermoaerophilus GN=satB PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANITNLVNKVLNVKSNYDGEQSASHTLTVKE DDIAFDQTS*(69)GETFRVVLPSGVKWKTAPANTPTAKFDLRSDQVLEVTVKGTNTIADDEQVS IPLNFKVDGATGELKLKVESMDSTITSGEYVFAIVGSGSTTAAVDNVKNIGKSGKAGTIR VEETAIGAVADGRNHKVKLKLPSNFRWVTTGTDKTEISTSGGFTSASIVTGESNDNVLVL DVATATGQGRGVLYVTPYIKADKDASYGDVSVNIRGPDFSDSDVVVAKYGDWGATIKVEK VEEVLAGKYDENTRTAKITIEESVPGSFVKGRDIDVELPSWVKVTDIKEFTTSGFTTGAP TSGSVDIDGTDNKISIPLGETGGSSTAKIEFKLELSVQADKTGDIEAVISGGGVAEQKAV IAKAVAPVSVALDGEASKVKIGAQAQDAPNIIITELKKGAIEKTTENGSTT*(471)NGTIEVKLP DGVKFASVPKVEVVEGDGTIDVDNVRRINNDNVLTIPVKGESVSKPMKIKLSNVKLTVDR TVPEGDIELKVGGNAIVENYKSGKGWLKGNKQNGSSDALDAGEFNTEHAAKVVVAKTVTP APTDTTATNIVFKLNSKTYTVDGKEFEMDAAPLVGWDRAYLPVRFAANALNVSDDQIVWD DKTSTFTIFKGDRVISGKVGDKFLTVNGAKVPMDVPVWRNKEKTNNRVMVPIRYLANALN AEIEWNKETSEITIQAKK
Sequence Around Glycosites (21 AA) IEKTTENGSTTNGTIEVKLPD
KEDDIAFDQTSGETFRVVLPS
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining
Technique(s) used for Glycosylated Residue(s) Detection Modified Edman degradation
Glycan Information
Glycan Annotation Linkage: β-GalNAc-Ser/Thr.
Total carbohydrate content of 15%.
Disaccharide repeating unit composed of L-rhamnose and D-glycero-D-manno-heptose residues: →4)-α-L-Rhap-(1→3)-β-D-glycero-D-manno-Hepp-(1→ and β-D-GalpNAc-(1→O)-Ser/Thr linkage. Equal amounts of the complete core structure α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-β-D-GalpNAc-(1→O)-Ser/Thr and the truncated forms α-L-Rhap-(1→3)-β-D-GalpNAc-(1→O)-Ser/Thr and β-D-GalpNAc-(1→O)-Ser/Thr are present. The different cores were substituted with varying numbers of disaccharide repeating units.
BCSDB ID23143, 943
Literature
Year of Identification1995
Year of Identification Month Wise1995.12.25
Year of Validation 1999
ReferenceMessner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
AuthorMessner, P., Steiner, K., Zarschler, K. and Schaffer, C
Research GroupUniversity of Natural Resources and Applied Life Sciences, Vienna, Center for NanoBiotechnology A-1180 Vienna, Gregor-Mendel-Strasse 33, Austria.
Corresponding Author Schaffer, C.
ContactUniversity of Natural Resources and Applied Life Sciences, Vienna, Center for NanoBiotechnology A-1180 Vienna, Gregor-Mendel-Strasse 33, Austria.
Reference Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. and Messner, P. (2001) Biosynthesis of nucleotide-activated D-glycero-D-manno-heptose. J Biol Chem, 276, 20935-20944. [PubMed: 11279237]
Author Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. and Messner, P.
Research GroupCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Natural Resources and Applied Life Sciences, Vienna, Gregor-Mendel-Strasse 33, A-1180 Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Natural Resources and Applied Life Sciences, Vienna, Gregor-Mendel-Strasse 33, A-1180 Vienna, Austria.
Reference Wugeditsch, T., Zachara, N.E., Puchberger, M., Kosma, P., Gooley, A.A. and Messner, P. (1999) Structural heterogeneity in the core oligosaccharide of the S-layer glycoprotein from Aneurinibacillus thermoaerophilus DSM 10155. Glycobiology, 9, 787-795.[PubMed: 10406844]
Author Wugeditsch, T., Zachara, N.E., Puchberger, M., Kosma, P., Gooley, A.A. Messner, P.
Research GroupCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Soil Culture, A-1180 Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Soil Culture, A-1180 Vienna, Austria.
Reference Kosma, P., Wugeditsch, T., Christian, R., Zayni, S. and Messner, P. (1995) Glycan structure of a heptose-containing S-layer glycoprotein of Bacillus thermoaerophilus. Glycobiology, 5, 791-796. [PubMed: 8720077]
Author Kosma, P., Wugeditsch, T., Christian, R., Zayni, S. Messner, P.
Research GroupInstitute of Chemistry, University of Natural Resources and Applied Life Sciences, Vienna, Austria
Corresponding Author Messner, P.
ContactInstitute of Chemistry, University of Natural Resources and Applied Life Sciences, Vienna, Austria