ProGP122

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP122
Validation Status Characterized
Organism Information
Organism NameAneurinibacillus thermoaerophilus L420-91T (DSM 10154) and GS4-97
Domain Bacteria
Classification Family: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 143495
Genome Sequence(s)
GenBank AY395578
EMBL AY395578
Gene Information
Gene Namesat A
Protein Information
Protein NameSurface-layer glycoprotein SatA
UniProtKB/SwissProt ID Q6TL22
EMBL-CDSAAS44591.1
UniProtKB Sequence >tr|Q6TL22|Q6TL22_ANETH Surface-layer glycoprotein SatA OS=Aneurinibacillus thermoaerophilus GN=satA PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANSTNLVDKRVQVGSNSEINGTSHLIVKEDD KKFRVSTGDTFRVELPAGTEWKFSDSEFYVDGSGNVYSSESSASPDTKAKVNVISSRTIE VRPLGNGFKSGDPDSKNAINIPLHVKVNGASGELKLKIDSMNSTVTSGEYVFATVNTGNT RAVVDTVRYIGKNGIGGQIRIDENFAGAISAGTHSLKLKLPSNFEWDDMSSGEIKFGGSF FGNAKVDGAIIGNGDNTLTIPVKISQSTSGATPGYIYITPKIKAKSDAAKGTDVTVNISG GDFSDADLTVAKYGDYDANIKVEKVEELVAGKFDEYTKTAKITIEESVPGSFYKDRDIDV KFPSWVKVVEVSDWSTSGVKANKPKNIDGTDDEFSIKIEEPTTKENTTPGRIEFKVRLSI DANKTGDIEATVSGGGIKEQKAVVAKAIAPAAVSVEGDTSKLKIGAQDQEGPTFYITEAK KGVFEKNVEGPSGNGEIIVRLASGVKFSKVPKVEVVEGDGPIDTSNVRRIENDNALAIPI KGESTSKPMKLKVSDVRLTLDRTVPEGDIEAKIGGSAVVENYVKDSKGWVGTGLYTGTDN KNPGTFNTQHAVTFKIGSTITPAPSDTTAKNIVFKLNSKTYTVDGKEIEMDAAPLVGWDR AYLPVRFAANALNVSDDQIIWDDKTSTFTIFKGDRVISGKVGDKFLTINGVKTPMDVPVW RNKEKTNNRVMVPIRYLANALNAEINWNKETSEITIQVK
Sequence length 759 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT67
Experimentally Validated Glycosite(s ) in Mature ProteinT67
Glycosite(s) Annotated Protein Sequence >tr|Q6TL22|Q6TL22_ANETH Surface-layer glycoprotein SatA OS=Aneurinibacillus thermoaerophilus GN=satA PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANSTNLVDKRVQVGSNSEINGTSHLIVKEDD KKFRVST*(67)GDTFRVELPAGTEWKFSDSEFYVDGSGNVYSSESSASPDTKAKVNVISSRTIE VRPLGNGFKSGDPDSKNAINIPLHVKVNGASGELKLKIDSMNSTVTSGEYVFATVNTGNT RAVVDTVRYIGKNGIGGQIRIDENFAGAISAGTHSLKLKLPSNFEWDDMSSGEIKFGGSF FGNAKVDGAIIGNGDNTLTIPVKISQSTSGATPGYIYITPKIKAKSDAAKGTDVTVNISG GDFSDADLTVAKYGDYDANIKVEKVEELVAGKFDEYTKTAKITIEESVPGSFYKDRDIDV KFPSWVKVVEVSDWSTSGVKANKPKNIDGTDDEFSIKIEEPTTKENTTPGRIEFKVRLSI DANKTGDIEATVSGGGIKEQKAVVAKAIAPAAVSVEGDTSKLKIGAQDQEGPTFYITEAK KGVFEKNVEGPSGNGEIIVRLASGVKFSKVPKVEVVEGDGPIDTSNVRRIENDNALAIPI KGESTSKPMKLKVSDVRLTLDRTVPEGDIEAKIGGSAVVENYVKDSKGWVGTGLYTGTDN KNPGTFNTQHAVTFKIGSTITPAPSDTTAKNIVFKLNSKTYTVDGKEIEMDAAPLVGWDR AYLPVRFAANALNVSDDQIIWDDKTSTFTIFKGDRVISGKVGDKFLTINGVKTPMDVPVW RNKEKTNNRVMVPIRYLANALNAEINWNKETSEITIQVK
Sequence Around Glycosites (21 AA) KEDDKKFRVSTGDTFRVELPA
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS)-staining
Technique(s) used for Glycosylated Residue(s) Detection N-terminal sequencing and C-13 NMR
Glycan Information
Glycan Annotation Linkage: β-GalNAc-Ser/Thr.
Hexasaccharide repeating unit (an average of 15 repeats) with the constituents D-rhamnose and 3-N-acetyl-D-fucosamine (3-acetamido-3,6-dideoxy-D-galactose); and β-D-GalNAc-Ser/Thr linkage. An O-methyl group on the non-reducing terminal rhamnose.
BCSDB ID23142
Literature
Year of Identification1995
Year of Identification Month Wise1995.12.25
Year of Validation 1999
ReferenceMessner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
AuthorMessner, P., Steiner, K., Zarschler, K. and Schaffer, C
Research GroupUniversity of Natural Resources and Applied Life Sciences, Vienna, Center for NanoBiotechnology A-1180 Vienna, Gregor-Mendel-Strasse 33, Austria.
Corresponding Author Schaffer, C.
ContactUniversity of Natural Resources and Applied Life Sciences, Vienna, Center for NanoBiotechnology A-1180 Vienna, Gregor-Mendel-Strasse 33, Austria.
Reference Pfoestl, A., Hofinger, A., Kosma, P. and Messner, P. (2003) Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-galactose in Aneurinibacillus thermoaerophilus L420-91T. J Biol Chem, 278, 26410-26417. [PubMed: 12740380]
Author Pfoestl, A., Hofinger, A., Kosma, P. and Messner, P.
Research GroupCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Natural Resources and Applied Life Sciences, Vienna, A-1180 Vienna, Austria.
Corresponding Author Messner, P.
ContactCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Natural Resources and Applied Life Sciences, Vienna, A-1180 Vienna, Austria.
Reference Schaffer, C., Muller, N., Christian, R., Graninger, M., Wugeditsch, T., Scheberl, A. and Messner, P. (1999) Complete glycan structure of the S-layer glycoprotein of Aneurinibacillus thermoaerophilus GS4-97. Glycobiology, 9, 407-414. [PubMed: 10089215]
Author Schaffer, C., Muller, N., Christian, R., Graninger, M., Wugeditsch, T., Scheberl, A. Messner, P.
Research GroupCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Soil Culture, A-1180 Vienna, Austria.
ContactCenter for Ultrastructure Research and Ludwig Boltzmann Institute for Molecular Nanotechnology, University of Soil Culture, A-1180 Vienna, Austria.
Reference Kosma, P., Neuninger, C., Christian, R., Schulz, G. and Messner, P. (1995) Glycan structure of the S-layer glycoprotein of Bacillus sp. L420-91. Glycoconj J, 12, 99-107.[PubMed: 7795419]
Author Kosma, P., Neuninger, C., Christian, R., Schulz, G. Messner, P.
Research GroupInstitute of Chemistry, University of Natural Resources and Applied Life Sciences, Vienna, Austria
Corresponding Author Messner, P.
ContactInstitute of Chemistry, University of Natural Resources and Applied Life Sciences, Vienna, Austria