ProGP137

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP137
Validation Status Uncharacterized
Organism Information
Organism NamePhormidium uncinatum
Domain Bacteria
Classification Order: Oscillatoriales
Division or phylum: "Cyanobacteria"
Taxonomic ID (NCBI) 60848
Genome Sequence(s)
GenBank AF002131
EMBL AF002131
Protein Information
Protein NameOscillin (65.8 kDa)
EMBL-CDSAAC46039.1
UniProtKB Sequence >tr|O51813|O51813_9CYAN Oscillin OS=Phormidium uncinatum PE=4 SV=1 MTTLDDNPNQLDLNLPGLGPDTIFAGGGADFIRTATLGGSLIFGQGDYDTLIALGPNDTL YGGDDEDSLRTQRTPAYLYGDGGNDTIIAEARATMYGGAADDFIQGTAEANLMFGNEGAD IMLGGAQRRDSLYGGKGNDSIGFFTGAGDGSNNLGLNLSGGIAGFVGNEGNNFLRGDLGD DLLAAINQRDTLYGGKGKDTLRVVGSNSYASGDDDSDILRVVNTLETNFFSTSPVTIGLE RTTLLGGAGDDSLYGGIGDFRGGKNFYDGGDGNDTIVSFAFQDTVLGSDGNDFITSSTAT GISSQGANISTPGYSGNSLLDGGRGNDTIRAAFSTDTMIGGEGSDSLSGVFTQASGADGD DTIDASLAANFGPITLDGGLGNDRLIGNRSATNFFNGGEGNDFIVFASTGDSLIGSFGGN DTISYATNVSFGNITTPTVISDFLGNNLITGGNGRDSITTGAGNDILIGGPQGDLSTDTL DGGDGDDSLYGDFGNDNLIGGNGNDTLVGGPGSDTLTGGSGNDVFVYFNPFEGGTVTAQV DGIVDFVVGQDRIALSSTGLPGGAGFGFPISGVANRRPLDREFLVLEDVLATGTQAEANA PAQFLVYENLSGNLYFDTNGVSAGGLVTVANINNRPRISESDIILF
Sequence length 646 AA
Subcellular LocationSurface
Function Has a Ca2+-binding motif. The structure of oscillin appears to favour a passive role in gliding.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid- Schiff reagent (PAS) staining and deglycosylation with TFMS (trifluoromethanesulfonic acid).
Literature
Year of Identification1997
Year of Identification Month Wise1997.10.
ReferenceHoiczyk, E. and Baumeister, W. (1997) Oscillin, an extracellular, Ca2+-binding glycoprotein essential for the gliding motility of cyanobacteria. Mol Microbiol, 26, 699-708. [PubMed: 9427400]
Author Baumeister, W.
Research GroupMax Planck Institute for Biochemistry, Molecular Structure Biology, Martinsried, Germany.
Corresponding Author Hoiczyk, E. Baumeister, W.
ContactMax Planck Institute for Biochemistry, Molecular Structure Biology, Martinsried, Germany.