ProGP142

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP142
Validation Status Uncharacterized
Organism Information
Organism NamePseudomonas putida GR12-2
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 303
Genome Sequence(s)
GenBank AJ784158
EMBL AJ784158
Gene Information
Gene NameafpA
Protein Information
Protein NameAntifreeze protein
UniProtKB/SwissProt ID Q68VA9
EMBL-CDSCAH04619.1
UniProtKB Sequence >tr|Q68VA9|Q68VA9_PSEPU Antifreeze protein OS=Pseudomonas putida GN=afpA PE=4 SV=1 MQYDSPITNTEFQTFLTTSSISDDTAAAISTLLNLDSADTINLASWDGVNAPEIPTGQEG AADVVIVNVPGAATDLVPVEIPDSLNSAKAFIFDSNASLAVTFDAPVAAESASLARVAAD TTAGIEFLVTTGAGNDVITVNGDQNSYIDAGNGNDTIVTGNGNNTVVAGAGNNNVTTGTG NDTIILSGTGHTDIVNTGAGYDVVQLDGSAADYTITAGNSNNVTLTGAQTAAITGAEFLT FADGSSVALAQSEAEASALRLYEGILGRDADQGGAQNFIAQVEAGTALTDIANSFLNSAE FGGAATEASIDSLYTSLLGRGADTAGSDSWEAIIANGGSLADVAAGIAGSAEAQEQDQSN GTFVDSLYLNALGRPSDEAGHDAWVAQLFNGASRAEVAAGIVGSAEAAEKINSDFIDALY LSATGRASDEAGKAGWTEVLANGGTQADVAIGIVGSQEAIAHNDNVVVLHGAV
Sequence length 473 AA
Subcellular LocationSecreted
Function This 164-kDa glycoprotein has both antifreez activity and ice-nucleation activity.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining
Glycan Information
Glycan Annotation Glycosylation does not seem to have any effect on antifreez activity while its removal decreases the ice-nucleation activity. The protein is relatively rich Gly and Ala.
Literature
Year of Identification1998
Year of Identification Month Wise1998.01
ReferenceXu, H., Griffith, M., Patten, C.L. and Glick, B.R. (1998) Isolation and characterization of an antifreeze protein with ice nucleation activity from the plant growth promoting rhizobacterium Pseudomonas putida GR12-2. Can J Microbiol, 44, 64–73.
Author Xu, H., Griffith, M., Patten, C.L. Glick, B.R.
Research GroupUniversity of Southern Mississippi
Corresponding Author Glick, B.R.
ContactUniversity of Southern Mississippi