ProGP147

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP147
Validation Status Uncharacterized
Organism Information
Organism NameClostridium tyrobutyricum ATCC 25755
Domain Bacteria
Classification Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1519
Genome Sequence(s)
GenBank AJ242662
EMBL AJ242662
Gene Information
Gene Namefla
Protein Information
Protein NameFlagellin
UniProtKB/SwissProt ID P80583
EMBL-CDSCAB44444.1
UniProtKB Sequence >sp|P80583|FLA_CLOTY Flagellin (Fragment) OS=Clostridium tyrobutyricum GN=fla PE=1 SV=2 MIINHNLMANNALRNMNVNSNNASKAMEKLSSGLRINRAGDDAAGLAISEKMRGQINGLN QASSNAQDSISLIQTAEGALNETHSILQRMRTLAVQSSNDTNTTTDRSAIQDEVNQLTDE IDRIANTTEFNTQKLLDGSKVGLVDAKDADASVQLNTSANISLASNFSTTSATGIADSFT VTITRTHGTAGATFASTDYDVALVGGTELIEHSSSSLTYDTKAINLVGMIKCFSIRTNDT IRKVSHVRTVKALSMQIGAIVTNMLIGINSMKATDIGVRNTSGKALDISTASKATGAITQ INNAIETVSTQRSKLGAYQNRLEHTINNLGTSSENLTSAESRIRDVDMASEMSEYSKNNI LSQTAQAMLAQANQQTQ
Sequence length 377 AA
Subcellular LocationFlagellum)
Function Flagellin is the subunit protein which polymerizes to form the filaments of flagella.
Literature
Year of Identification1998
Year of Identification Month Wise1998.02
ReferenceBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Binet, A. (1998) Evidence for an heterogeneous glycosylation of the Clostridium tyrobutyricum ATCC 25755 flagellin. Microbios, 94, 183-192. [PubMed: 9853380]
AuthorBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Binet, A
Research GroupUniversity of Western Brittany, University Institute of Technology of Quimper, University Laboratory of Applied Microbiology of Quimper, France.
Corresponding Author Binet, A
ContactUniversity of Western Brittany, University Institute of Technology of Quimper, University Laboratory of Applied Microbiology of Quimper, France.
ReferenceBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Malcoste, R. (1998) Partial analysis of the flagellar antigenic determinant recognized by a monoclonal antibody to Clostridium tyrobutyricum. Microbiol Immunol, 42, 87-95. [PubMed: 9572040]
AuthorBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. Malcoste, R.
Research GroupUniversity of Western Brittany, University Institute of Technology of Quimper, University Laboratory of Applied Microbiology of Quimper, France
Corresponding Author Malcoste, R.
ContactUniversity of Western Brittany, University Institute of Technology of Quimper, University Laboratory of Applied Microbiology of Quimper, France
ReferenceBeguin, P. and Lemaire, M. (1996) The cellulosome: an exocellular, multiprotein complex specialized in cellulose degradation. Crit Rev Biochem Mol Biol, 31, 201-236.
AuthorBeguin, P. Lemaire, M.
Research GroupUnit of Cell Physiology and URA 1300 CNRS, Department of Biotechnology, Institut Pasteur, Paris, France.
Corresponding Author Lemaire, M.
ContactUnit of Cell Physiology and URA 1300 CNRS, Department of Biotechnology, Institut Pasteur, Paris, France.