ProGP15

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP15
Validation Status Uncharacterized
Organism Information
Organism NameEnterococcus hirae (formerly Streptococcus faecium ATCC 9790)
Domain Bacteria
Classification Family: Enterococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1354
Genome Sequence(s)
GenBank M77639
EMBL M77639
Protein Information
Protein NameN-acetylmuramoylhydrolase (Muramidase-2)
UniProtKB/SwissProt ID P39046
EMBL-CDSAAA24776.1
UniProtKB Sequence >sp|P39046|MUR2_ENTHR Muramidase-2 OS=Enterococcus hirae PE=1 SV=1 MENIARKERRRLNETKRFRKVKRSAALVGTAMVGCSVAAPLIQPVQVDADQTPTQFGARI NTAAFIAEIATYAQPIAQANDLYASVMIAQAVVESGWGSSALSQAPYYNLFGIKGSYQGQ TVYMDTLEYLNNKWVSKKEPFRQYPSFAESFNDNAYVLRNTSFGNGYYYAGTWKSNTKSY TDATACLTGRYATDPGYAGKLNNIITTYGLTKYDTPASGNAGGGVTIGNGGNTGNTSNSG STSGNSGGSATTTGTTYTVKSGDSVWGISHSFGITMAQLIEWNNIKNNFIYPGQKLTIKG GQSAGSSTTNTGNNASSGNTSGNTNTSGSTGQATGAKYTVKSGDSVWKIANDHGISMNQL IEWNNIKNNFVYPGQQLVVSKGSSSASGSTSNTSTGNTSSNTANTGSTTSGSTYTVKAGE SVWSVSNKFGISMNQLIQWNNIKNNFIYPGQKLIVKGGSSSSNASTSTANNKNTASSNTS STATGQATYTVKAGESVWGVANKNGISMNQLIEWNNIKNNFIYPGQKLIVKGGSSKASAT ATIKPTASTPASTTPTASSTGDTKYTVKAGESVWGVANKHHITMDQLIEWNNIKNNFIYP GQEVIVKKGTAQSTPAKSDEKTYTVKAGESVWGVADSHGITMNQLIEWNNIKNNFIYPGQ QLIVKK
Sequence length 666 AA
Subcellular LocationSecreted
Function It has an endogenous, autolytic peptidoglycan hydrolase activity with a single specificity that is β-1,4-N-acetylmuramoylhydrolase (muramidase; EC 3.2.1.17).
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining and binding to concanavalin A-Sepharose 4B column
Glycan Information
Glycan Annotation Glucose monomers and glucose oligosaccharides.
Literature
Year of Identification1983
Year of Identification Month Wise1983.1
ReferenceKawamura, T. and Shockman, G.D. (1983) Purification and some properties of the endogenous, autolytic N-acetylmuramoylhydrolase of Streptococcus faecium, a bacterial glycoenzyme. J Biol Chem, 258, 9514-9521. [PubMed: 6874701]
Author Shockman, G.D.
Research GroupDepartment of Microbiology and Immunology, Temple University School of Medicine, Philadelphia, Pennsylvania
Corresponding Author Kawamura, T. Shockman, G.D.
ContactDepartment of Microbiology and Immunology, Temple University School of Medicine, Philadelphia, Pennsylvania