ProGP172

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP172
Validation Status Uncharacterized
Organism Information
Organism NameCellulomonas fimi
Domain Bacteria
Classification Family: Cellulomonadaceae
Suborder: Micrococcineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1708
Genome Sequence(s)
GenBank AF126471
EMBL AF126471
Gene Information
Gene Nameman26A
Protein Information
Protein NameMan26A (b-mannosidase 26A)
UniProtKB/SwissProt ID Q9XCV5
EMBL-CDSAAD42774.1
UniProtKB Sequence >tr|Q9XCV5|Q9XCV5_CELFI Man26A OS=Cellulomonas fimi GN=man26A PE=1 SV=1 MTNRSRPRGRTAGHVLAATAAALALTGLSALPAQSAPAPAAPVAGALPTAPADETIAIVD ADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWD TLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDT LRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSP GEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDS TGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKAD PVASRNAYMETWANFDAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAP AQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQGGTVVDTLDLAYDGALWWT APWSPTSAQLDNSTYTVTATATTAAGTLDVTNEVVLGPRPTFPAGVVDDFEGYGDDTALR AEYVTYGANTISLETGSVGGGAKALRLDYDFATQTYTGVGKQLSGDWSDFNELAIWVDPD GSNNRMVLQLNAGGVAYEAYPSLAGDEPQLVTIPFVDWRPAPWDTAHADRRMSDDDLRAL TSFNVYVNSAEGGAASGSLVVDDIAAHPGVEPPPLFSDVPKGHPYETEILWLHAQGLDDG YDDGTFRPARQVKRQDVARLLHAYEKAVFTPPTTPSFLDVRRSHPAYTAIEWLVAEGLVD DGRVFLPSAPLDRATAAELLWRLAGSPEPEGTEAFRDVPTWHRYRTAITWATEVGVVEPV SASTFGVLKAVQRQELARYLYRFDALPSPLEPVVLSDFADGAQGWGPLDAGPGSATASGG TLTIEAAAPDGGWFSFTPSVADWTGRTALALDVVSTTGFDTKAALQVGSTWQWCETAQAG WVSGPRTGDDALVLDLTTLYAGCGAQLADVKRVNLYLNAGTHVIDDVELR
Sequence length 1010 AA
Subcellular LocationSecreted
Function catalyze the removal of b-D-mannose residues from the nonreducing ends of oligosaccharides
Protein Structure
PDB ID 2BVT, 2BVY, 2X2Y
Literature
Year of Identification1999
Year of Identification Month Wise1999.6
ReferenceStoll, D., Stalbrand, H. and Warren, R.A. (1999) Mannan-degrading enzymes from Cellulomonas fimi. Appl Environ Microbiol, 65, 2598-2605. [PubMed: 10347049]
AuthorStoll, D., Stalbrand, H. and Warren, R.A
Research GroupDepartment of Microbiology and Immunology and The Protein Engineering Network of Centres of Excellence, The University of British Columbia, Vancouver, British Columbia, Canada.
Corresponding Author Warren, R.A
ContactDepartment of Microbiology and Immunology and The Protein Engineering Network of Centres of Excellence, The University of British Columbia, Vancouver, British Columbia, Canada.