ProGP176

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP176
Validation Status Uncharacterized
Organism Information
Organism NameHelicobacter felis CS1
Domain Bacteria
Classification Family: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 936155
Genome Sequence(s)
GenBank FQ670179.2
EMBL FQ670179
Gene Information
Gene NameflaB (Hfelis_04690)
NCBI Gene ID 10051385
Protein Information
Protein NameFlagellin B
UniProtKB/SwissProt ID E7A9M7
NCBI RefSeq YP_004073143.1
EMBL-CDSCBY82553.1
UniProtKB Sequence >tr|E7A9M7|E7A9M7_HELFC Flagellin domain protein OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=flaB PE=4 SV=1 MSFRINTNVAALNAHTIGVRNNRDLSTSLEKLSSGLRINKAADDASGMAIADSLRSQSAS LGQAVRNANDAIGVVQTADKAMDEQIKILDTVKTKAVQAAQDGQTAETRKALQSDILRLL EELDNIANTTSFNGQQLLAGSFSNKEFQIGAYSNTTIKASIGPTGSDKIGHVRFETSAMD RGGMEVSAGAQNLKEVTLNFKQADAVNDFKLESVKISTSAGTGLGALVNVINKNSSTLGV RATAVVLGTGENSVESGTINGLTINGVLIGNVNDVQHNDRDGRLTNAINSVKERTGVEAY TDIQGRINLRSTDGRAISVHADGKTGHVFGGGNFRGISGNAHAIVGRLTLTKENARDIIV SGVNFSHVGLHSAQGVAEYTVNLQAIRGVFDANAASAGGGNANAAQAAFNFKGIGAGVTS LRGAMMVMDMAESARIQLDKIRSDLGSVQMELVTTINNISVTQVNVKAAESQIRDVDFAE ESASFSKFNILAQSGSFAMAQANAVQQNVLRLLQ
Sequence length 514 AA
Subcellular LocationSecreted
Function FlaA and FlaB are co-assembled into one flagellar flament. H. felis flaB mutants have truncated flagella.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDIG (digoxigenin)-tagged hydrazine labeling after periodate treatment.
Literature
Year of Identification1999
Year of Identification Month Wise1999.7
ReferenceJosenhans, C., Ferrero, R.L., Labigne, A. and Suerbaum, S. (1999) Cloning and allelic exchange mutagenesis of two flagellin genes of Helicobacter felis. Mol Microbiol, 33, 350-362. [PubMed: 10411751]
AuthorSuerbaum, S.
Research GroupRuhr-University Bochum, Department of Medical Microbiology, D-44780 Bochum, Germany.
Corresponding Author Josenhans, C., Ferrero, R.L., Labigne, A. Suerbaum, S.
ContactRuhr-University Bochum, Department of Medical Microbiology, D-44780 Bochum, Germany.