ProGP185

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP185
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842581.1
EMBL BX842581
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene Namempt83 (Rv2873)
NCBI Gene ID 887155
Protein Information
Protein NameMpt83 (Cell surface lipoprotein)
UniProtKB/SwissProt ID P0A670
NCBI RefSeq NP_217389.1
EMBL-CDSCAA98350.1
UniProtKB Sequence >sp|P0A670|MP83_MYCTU Cell surface lipoprotein MPT83 OS=Mycobacterium tuberculosis GN=mpt83 PE=4 SV=1 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLI GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ
Sequence length 220 AA
Subcellular LocationMembrane
Function Lipoprotein
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2000
Year of Identification Month Wise2000.02
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
ReferenceHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240]
AuthorHerrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. Young, D.
Research GroupDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK
Corresponding Author Young, D.
ContactDepartment of Infectious Diseases and Microbiology, Imperial College School of Medicine, St. Marys Campus, Norfolk Place, W2 1PG, London, UK