ProGP188

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP188
Validation Status Uncharacterized
Organism Information
Organism NameButyrivibrio fibrisolvens OR77
Domain Bacteria
Classification Family: Lachnospiraceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 831
Genome Sequence(s)
GenBank AF026811
EMBL AF026811
Gene Information
Gene NameflaA
Protein Information
Protein NameflaA
UniProtKB/SwissProt ID O31059
EMBL-CDSAAB82610.1
UniProtKB Sequence >tr|O31059|O31059_BUTFI Flagellin A protein OS=Butyrivibrio fibrisolvens GN=flaA PE=4 SV=1 MVVQHNMQAANASRMLGITTGDQSKSTEKLSSGFKINRAADDAAGLSISEKMRKQIRGLD QASTNASDGISAVQTAEGALTEVHSMLQRMNELAVQAANGTNSESDRSSIQDEINQLTTE IDRVAETTKFNETYLLKGGNGDRTVRVYAHDAGLVGSLSQNTTKATFQMRKLEIGDSYTI GGTTYKIGAETVKEAMTALKITSAASSSDDKITALKTGDVIKIDGKSFTIDENETDMEQS RIKATMINKLAGAGSTLEFNGRVTVFSVDVGTGVNGVDPNNKTLITATAAYFRVKTELIA ASSVGATNTRAAIIGDPDIGATYVNFTITRGDVISKNTLVFTLHVGSDADMTNKIGVEID TMDAKSLGIHGMNVSDDTGKAATYAIDAISDALAKVSAQRSALGSIQNRLEHSIANLDNV VENTNAAESRIRDTDMADEMVTYSKNNILMQAGQSMLAQANQATQGVLSILQ
Sequence length 472 AA
Subcellular LocationFlagellum
Function Component of flagellum.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein staining with Alcian blue, and DIG glycan detection.
Literature
Year of Identification2000
Year of Identification Month Wise2000.04
ReferenceKalmokoff, M.L., Allard, S., Austin, J.W., Whitford, M.F., Hefford, M.A. and Teather R.M. (2000) Biochemical and Genetic Characterization of the Flagellar Filaments from the Rumen Anaerobe Butyrivibrio fibrisolvens OR77. Anaerobe, 6, 93-109.
Author Kalmokoff, M.L., Allard, S., Austin, J.W., Whitford, M.F., Hefford, M.A. Teather R.M.
Research GroupCentre for Food and Animal Research, Agriculture and Agri-Food Canada, Ottawa, ON, Canada, K1A 0C6, Bureau of Microbial Hazards, Health Protection Branch, Health Canada, Ottawa, ON, Canada, K1A 0L2
Corresponding Author Teather R.M.