ProGP189

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP189
Validation Status Uncharacterized
Organism Information
Organism NameButyrivibrio fibrisolvens OR77
Domain Bacteria
Classification Family: Lachnospiraceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 831
Genome Sequence(s)
GenBank AF026812
EMBL AF026812
Gene Information
Gene NameflaB
Protein Information
Protein NameflaB
UniProtKB/SwissProt ID O31062
EMBL-CDSAAB82613.1
UniProtKB Sequence >tr|O31062|O31062_BUTFI FlaB OS=Butyrivibrio fibrisolvens GN=flaB PE=4 SV=1 MVVQHNMQAANSSRTLNITTDAQSKSTEKLSSGYKINRAADDAAGLSISEKMRKQIRGLG QASTNASDGVSSVQTAEGALTEVHDMLQRMNELAVQAANGTNSESDRSDIQNEIDQLTQE IDRIASTTKFNETFLLKGDVGLRRMYINAHDAGLDGTLIQNTTRATFTMESLEAGERYTI GGTQYTIGASTNQEVAEALHLTQYYTAGATPTAAGTWKLTAGDTISIDGKTYTINADDIG TDIANAKVTNGYLAKLITKGSTVKYNGNEVTRFSTSYNSSTGIDDANVTLIKATAAYKMV AIXLKAASSIGATHGPASMDTAKTTSADGKVKAGDYIWEKHNIKKTVDGKEITSTTYSFS ITKGFVNIQNALTLNLHVGADAAMTNKINVTLEAMNAKSIGIAGINVSDATGKNATYAID AITDAIQRVSAQRAELGAVQNRLEHSIKNLDNVVRNTEAAESRIRDTDMADTMVEYSKNN ILQQAGQSMLAQANQANQATQGVLQLLQ
Sequence length 508 AA
Subcellular LocationFlagellum
Function Component of flagellum.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein staining with Alcian blue, and DIG glycan detection.
Literature
Year of Identification2000
Year of Identification Month Wise2000.04
ReferenceKalmokoff, M.L., Allard, S., Austin, J.W., Whitford, M.F., Hefford, M.A. and Teather R.M. (2000) Biochemical and Genetic Characterization of the Flagellar Filaments from the Rumen Anaerobe Butyrivibrio fibrisolvens OR77. Anaerobe, 6, 93-109.
Author Kalmokoff, M.L., Allard, S., Austin, J.W., Whitford, M.F., Hefford, M.A. Teather R.M.
Research GroupCentre for Food and Animal Research, Agriculture and Agri-Food Canada, Ottawa, ON, Canada, K1A 0C6, Bureau of Microbial Hazards, Health Protection Branch, Health Canada, Ottawa, ON, Canada, K1A 0L2
Corresponding Author Teather R.M.