ProGP199

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP199
Validation Status Characterized
Organism Information
Organism NameAcidovorax (Pseudomonas) avenae K1 (H8301)
Domain Bacteria
Classification Family: Comamonadaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 80870
Genome Sequence(s)
GenBank AB040140
EMBL AB040140
Organism Additional Information Acidovorax avenae is a Gram-negative phytopathogenic bacterium. It is the causal agent of a seedling disease wherein brown stripes are formed on the sheaths of infected plants. This species has a broad host range among monocots while one or a few host species are infected by individual strains.
Gene Information
Gene NameflaA
Protein Information
Protein NameFlagellin
UniProtKB/SwissProt ID Q9FAE7
EMBL-CDSBAB16757.1
UniProtKB Sequence >tr|Q9FAE7|Q9FAE7_9BURK Flagellin OS=Acidovorax avenae subsp. avenae GN=H8301-fla1 PE=4 SV=1 MASTINTNVSSLTAQRNLSLSQSSLNTSIQRLSSGLRINSAKDDAAGLAISERFTSQIRG LNQAVRNANDGISLAQTAEGALKSTGDILQRVRELAVQSANATNSSGDRKAIQAEVGQLL SEMDRIAGNTEFNGQKLLDGSFGSATFQVGANANQTITATTGNFRTNNYGAQLTASASGA ATSGASAGSAGAAAGTVVIAGLQTKTVNVAASGTAADIASAVNAVADSTGVTASARNVSE LKFSGTGSFTLAVKGDNSTAANVTFNVSATSTAAGLAEAVKAFNDVSSQTGVTAKLNSDS SGLILTNESGNDINVANGASSAAGITLASQDAATTQSSGTLTFTTATAAGTGATVASRGT VEYKSDKGYTVSGTGGTMTTTAATSSTLTKVSDIDVSTVDGSTKALKIIDAALSAVNGQR ASFGALQSRFETTVNNLQSTSENMSASRSRIQDADFAAETANLSRSQILQQAGTAMVAQA NQLPQGVLSLLK
Sequence length 492 AA
Subcellular LocationSurface
Function Flagellin structural protein.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS178, S183, S212, T351
Experimentally Validated Glycosite(s ) in Mature ProteinS178, S183, S212, T351
Glycosite(s) Annotated Protein Sequence >tr|Q9FAE7|Q9FAE7_9BURK Flagellin OS=Acidovorax avenae subsp. avenae GN=H8301-fla1 PE=4 SV=1 MASTINTNVSSLTAQRNLSLSQSSLNTSIQRLSSGLRINSAKDDAAGLAISERFTSQIRG LNQAVRNANDGISLAQTAEGALKSTGDILQRVRELAVQSANATNSSGDRKAIQAEVGQLL SEMDRIAGNTEFNGQKLLDGSFGSATFQVGANANQTITATTGNFRTNNYGAQLTASAS*(178)GA ATS*(183)GASAGSAGAAAGTVVIAGLQTKTVNVAAS*(212)GTAADIASAVNAVADSTGVTASARNVSE LKFSGTGSFTLAVKGDNSTAANVTFNVSATSTAAGLAEAVKAFNDVSSQTGVTAKLNSDS SGLILTNESGNDINVANGASSAAGITLASQDAATTQSSGTLTFTTATAAGT*(351)GATVASRGT VEYKSDKGYTVSGTGGTMTTTAATSSTLTKVSDIDVSTVDGSTKALKIIDAALSAVNGQR ASFGALQSRFETTVNNLQSTSENMSASRSRIQDADFAAETANLSRSQILQQAGTAMVAQA NQLPQGVLSLLK
Sequence Around Glycosites (21 AA) NYGAQLTASASGAATSGASAG
LTASASGAATSGASAGSAGAA
LQTKTVNVAASGTAADIASAV
LTFTTATAAGTGATVASRGTV
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionHigher molecular mass detected on SDS-PAGE, Gel code glycoside detection kit (Pierce)
Technique(s) used for Glycosylated Residue(s) Detection HPLC analysis after digestion with trypsin and aspartic N-peptidase (sequencing), site-directed mutagenesis, MALDI-TOF MS (matrix-assisted laser desorption/ionization time of flight mass spectrometry).
Protein Glycosylation- Implication Glycosylation regulates the induction specificity of the immune responses (such as H2O2 generation) to flagellin. It prevents recognition of the flagellin epitope (of virulent strain K1) in rice. K1 flagellin without glycans induces a strong immune response in cultured rice cells.
Glycan Information
Glycan Annotation The sites are glycosylated by an approximately 540 Da glycan that may be a derivative of the glycan of P. syringae pv. tabaci.
Technique(s) used for Glycan Identification Mass spectroscopy
Literature
Year of Identification2000
Year of Identification Month Wise2000.10.13
Year of Validation 2011
ReferenceHirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S. (201Glycosylation regulates the specific induction of rice immune responses by Acidovorax avenae flagellin. J Biol Chem. ahead of print [PMID: 21628471]
AuthorHirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S.
Research GroupGraduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan
Corresponding Author Che, F.S.
ContactGraduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Nagahama, Shiga 526-0829, Japan
ReferenceChe, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A. (2000) Flagellin from an incompatible strain of Pseudomonas avenae induces a resistance response in cultured rice cells. J Biol Chem, 275, 32347-32356. [PubMed: 10922369]
AuthorChe, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A.
Research GroupGraduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan
Corresponding Author Isogai, A.
ContactGraduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5, Takayama Ikoma, Nara 630-0101, Japan