ProGP201

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP201
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium smegmatis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1772
Genome Sequence(s)
GenBank DQ066883.1
EMBL DQ066883
Gene Information
Gene Namehlp
NCBI Gene ID 4534852
Protein Information
Protein NameLaminin-binding glycoprotein (MS-LBP) or histone-like protein
UniProtKB/SwissProt ID Q4PLR8
NCBI RefSeq YP_886729.1
EMBL-CDSAAY68087.1
UniProtKB Sequence >tr|Q4PLR8|Q4PLR8_MYCSM Histone-like protein OS=Mycobacterium smegmatis GN=hlp PE=3 SV=1 MNKAELIDVLTTKMGTDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA RNPRTGETVKVKPTSVPAFRPGAQFKAVISGAQKLPADGPAVKRGVTAGPAKKAAKKAPA KKAAAKKTATKAAAKKAPAKKAATKAPAKKAATKAPAKKAATKAPAKKAATKAPAKKAAA KAPAKKAATKAPAKKAAAKKAPAKKGRR
Sequence length 208 AA
Function It is involved in laminin-mediated mycobacterial adherence to human pneumocytes and macrophages.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMALDI-TOF MS (matrix assisted laser desorption/ionization time of flight mass spectrometry) analysis and gas chromatography-mass spectrometry(GC-MS)
Literature
Year of Identification2001
Year of Identification Month Wise2001.1
ReferencePethe, K., Puech, V., Daffe, M., Josenhans, C., Drobecq, H., Locht, C. and Menozzi, F.D. (200Mycobacterium smegmatis laminin-binding glycoprotein shares epitopes with Mycobacterium tuberculosis heparin-binding haemagglutinin. Mol Microbiol, 39, 89-99. [PubMed: 11123691]
Author Pethe, K., Puech, V., Daffe, M., Josenhans, C., Drobecq, H., Locht, C. Menozzi, F.D.
Research GroupINSERM U447, Molecular Mechanisms of Microbial Pathogenesis, Pasteur Institute of Lille, 1 Rue A. Calmette, 59019 Lille Cedex, France.
Corresponding Author Menozzi, F.D.
ContactINSERM U447, Molecular Mechanisms of Microbial Pathogenesis, Pasteur Institute of Lille, 1 Rue A. Calmette, 59019 Lille Cedex, France.