ProGP205

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP205
Validation Status Uncharacterized
Organism Information
Organism NamePyrococcus furiosus DSM 3638
Domain Archaea
Classification Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2261
Genome Sequence(s)
GenBank AE009950.1
EMBL AE009950
Gene Information
Gene NamecbtA (PF1209)
NCBI Gene ID 1469079
Protein Information
Protein NameCbtA (Cellobiose binding protein
UniProtKB/SwissProt ID Q8U1J8
NCBI RefSeq NP_578938.1
EMBL-CDSAAL81333.1
UniProtKB Sequence >tr|Q8U1J8|Q8U1J8_PYRFU Oligopeptide ABC transporter (Oligopeptide-binding protein) OS=Pyrococcus furiosus GN=PF1209 PE=4 SV=1 MKRLVGVLIGAFVIFGVFGQVVAAQEQELPREETLYVGGGLWSQPNNFNPLIPWSAVTGT IGLIYETLFNYDPLNDKLEPWLAESGRWVSDNVYEVKLREGLTWQDGKPLTAEDVKFTFE LHKKYPGLAYHQMWEWLQEVKVIDDRTIQFVFSTPHYEEWKYLLYQIAIVPKHIWQNIDN PVEFANVDNPVGSGPYKLYKTDQMRFILVRNDNWWGIKYFGKPAPKYIVYVIVYSNNLAL SMLVKGELDWSNFFIPGVPDVKAQYGIVTWYDEPPYHLPANTAFLFLNTQKPPLDNPEFR RAIAYAINPEEIAARASQNQVTPADPTGLLIQYPAFKKIYNKEAVDKYGFKYDPQKAMEI LDKLGFKDVNGDGYREFPDGKPLKLTIIVPFGWTDWMEMIRVISEQLAIVGINVEPKFPD YSKYWDDLTKGNFDMAINNFGSNVVATPWQWFNWVLNQDVTPIGENFYNGNFGRYKNERV AELLELINVEKDENKKLQYYYELQEIFLKDLPYIPIIYNGAWFEASPEHWTNWPTAKNPY AFPISWNGYWQMGGVKVLLNIKPVKAATETTTTEEKTETIVQTVTVTPTETATSSTETGG ICGPAILVGLAVVPLLLRRRRS
Sequence length 622 AA
Subcellular LocationMembrane
Function High-affinity binding-protein-dependent ABC transport system for the uptake of cellobiose and most other β-glucosides.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding, Periodic acid- Schiff reagent (PAS) staining.
Literature
Year of Identification2001
Year of Identification Month Wise2001.8
ReferenceKoning, S.M., Elferink, M.G., Konings, W.N. and Driessen, A.J. (200Cellobiose uptake in the hyperthermophilic archaeon Pyrococcus furiosus is mediated by an inducible, high-affinity ABC transporter. J Bacteriol, 183, 4979-4984. [PubMed: 11489849]
Author Driessen, A.J.
Research GroupDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 90750 AA Haren, The Netherlands.
Corresponding Author Koning, S.M., Elferink, M.G., Konings, W.N. Driessen, A.J.
ContactDepartment of Microbiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, 90750 AA Haren, The Netherlands.