ProGP216

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP216
Validation Status Characterized
Organism Information
Organism NameHelicobacter pylori 1061/ J99
Domain Bacteria
Classification Family: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 85963
Genome Sequence(s)
GenBank AE001439.1
EMBL AE001439
Organism Additional Information Helicobacter pylori is a Gram-negative, microaerophilic, human gastric pathogen classified by WHO as a Type 1 carcinogen. Its lipopolysaccharide (LPS) O antigen is responsible for its virulence. Lewis antigens on its O polysaccharides mimic glycan structures on human cells and interact with the C-type lectin DC-SIGN on dendritic cells, thereby down-regulating an inflammatory response. It also causes chronic type B gastritis (a prerequisite for duodenal ulcers) and is linked with mucosa-associated lymphoid tissue (MALT) and with B-cell MALT lymphomas.
Gene Information
Gene NameflaA (jhp_0548)
NCBI Gene ID 889160
GenBank Gene Sequence 889160
Protein Information
Protein NameFlagellin A (FlaA)
UniProtKB/SwissProt ID P0A0S2
NCBI RefSeq NP_223266.1
EMBL-CDSAAD06133.1
UniProtKB Sequence >sp|P0A0S2|FLAA_HELPJ Flagellin A OS=Helicobacter pylori J99 GN=flaA PE=3 SV=2 MAFQVNTNINAMNAHVQSALTQNALKTSLERLSSGLRINKAADDASGMTVADSLRSQASS LGQAIANTNDGMGIIQVADKAMDEQLKILDTVKVKATQAAQDGQTTESRKAIQSDIVRLI QGLDNIGNTTTYNGQALLSGQFTNKEFQVGAYSNQSIKASIGSTTSDKIGQVRIATGALI TASGDISLTFKQVDGVNDVTLESVKVSSSAGTGIGVLAEVINKNSNRTGVKAYASVITTS DVAVQSGSLSNLTLNGIHLGNIADIKKNDSDGRLVAAINAVTSETGVEAYTDQKGRLNLR SIDGRGIEIKTDSVSNGPSALTMVNGGQDLTKGSTNYGRLSLTRLDAKSINVVSASDSQH LGFTAIGFGESQVAETTVNLRDVTGNFNANVKSASGANYNAVIASGNQSLGSGVTTLRGA MVVIDIAESAMKMLDKVRSDLGSVQNQMISTVNNISITQVNVKAAESQIRDVDFAEESAN FNKNNILAQSGSYAMSQANTVQQNILRLLT
Sequence length 510 AA
Subcellular LocationSecreted
Function Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. Important for motility and virulence.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Initiator Met removed) T181, T364, S208, S246, S354, S395, S405
Experimentally Validated Glycosite(s ) in Mature ProteinT180, T363, S207, S245, S353, S394, S404
Glycosite(s) Annotated Protein Sequence >sp|P0A0S2|FLAA_HELPJ Flagellin A OS=Helicobacter pylori J99 GN=flaA PE=3 SV=2 MAFQVNTNINAMNAHVQSALTQNALKTSLERLSSGLRINKAADDASGMTVADSLRSQASS LGQAIANTNDGMGIIQVADKAMDEQLKILDTVKVKATQAAQDGQTTESRKAIQSDIVRLI QGLDNIGNTTTYNGQALLSGQFTNKEFQVGAYSNQSIKASIGSTTSDKIGQVRIATGALI T*(181)ASGDISLTFKQVDGVNDVTLESVKVSS*(208)SAGTGIGVLAEVINKNSNRTGVKAYASVITTS DVAVQS*(246)GSLSNLTLNGIHLGNIADIKKNDSDGRLVAAINAVTSETGVEAYTDQKGRLNLR SIDGRGIEIKTDSVSNGPSALTMVNGGQDLTKGSTNYGRLSLTRLDAKSINVVS*(354)ASDSQH LGFT*(364)AIGFGESQVAETTVNLRDVTGNFNANVKSAS*(395)GANYNAVIAS*(405)GNQSLGSGVTTLRGA MVVIDIAESAMKMLDKVRSDLGSVQNQMISTVNNISITQVNVKAAESQIRDVDFAEESAN FNKNNILAQSGSYAMSQANTVQQNILRLLT
Sequence Around Glycosites (21 AA) QVRIATGALITASGDISLTFK
SASDSQHLGFTAIGFGESQVA
DVTLESVKVSSSAGTGIGVLA
VITTSDVAVQSGSLSNLTLNG
RLDAKSINVVSASDSQHLGFT
GNFNANVKSASGANYNAVIAS
SGANYNAVIASGNQSLGSGVT
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDIG Glycan/Protein Double Labelling (DIG-hydrazide labeling after periodate oxidation) followed by Western blot using anti-DIG antibodies.
Technique(s) used for Glycosylated Residue(s) Detection cLC/ESMS (capillary liquid chromatography electrospray mass spectrometry) and MS/MS (tandem mass spectrometry) after β-elimination with ammonium hydroxide
Glycan Information
Glycan Annotation Pseudaminic acid (Pse5Ac7Ac, 5,7-diacetamido-3,5,7,9-tetradeoxy-L-glycero-L-manno-nonulosonic acid). A total of seven O-linked Pse5Ac7Ac residues are present in FlaA protein.
BCSDB ID4618
Technique(s) used for Glycan Identification CE-ESMS (capillary electrophoresis-electrospray mass spectrometry), tandem mass spectrometry and precursor ion scanning with fe-CID (front-end collision-induced dissociation)
Literature
Year of Identification2002
Year of Identification Month Wise2002.6.1
Year of Validation 2003
ReferenceSchoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. et al. (2006) Structural and functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. J Biol Chem, 281, 8907-8916. [PubMed: 16421095]
Author Schoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. et al.
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6
Corresponding Author A., Logan,
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6
ReferenceSchirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. and Logan, S.M. (2003) Structural, genetic and functional characterization of the flagellin glycosylation process in Helicobacter pylori. Mol Microbiol, 48, 1579-1592. [PubMed: 12791140]
Author Schirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. Logan, S.M.
Research GroupUniversity of Montreal, Department of Chemistry, Canada.
Corresponding Author Logan, S.M.
ContactUniversity of Montreal, Department of Chemistry, Canada.
Reference Josenhans, C., Vossebein, L., Friedrich, S. and Suerbaum, S. (2002) The neuA/flmD gene cluster of Helicobacter pylori is involved in flagellar biosynthesis and flagellin glycosylation. FEMS Microbiol Lett, 210, 165-172. [PubMed: 12044670]
Author Josenhans, C., Vossebein, L., Friedrich, S. Suerbaum, S.
Research GroupInstitute of Hygiene and Microbiology, University of Würzburg, Josef-Schneider-Strasse 2, D-97080 Würzburg, Germany.
Corresponding Author Suerbaum, S.
ContactInstitute of Hygiene and Microbiology, University of Würzburg, Josef-Schneider-Strasse 2, D-97080 Würzburg, Germany.