ProGP217

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP217
Validation Status Uncharacterized
Organism Information
Organism NameBacillus anthracis str. Ames (Sterne 7702)
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1392
Genome Sequence(s)
GenBank AE016879.1
EMBL AE016879
Organism Additional Information Bacillus anthracis is a Gram-positive bacterium that forms spores, the causal agent of anthrax. This lethal infection involves both toxaemia and septicaemia.
Gene Information
Gene NamebclA (BA_1222)
NCBI Gene ID 1084744
Protein Information
Protein NameBclA (collagen-like protein)
UniProtKB/SwissProt ID Q81JD7
NCBI RefSeq NP_843695.1
EMBL-CDSAAP25181.1
UniProtKB Sequence >tr|Q81JD7|Q81JD7_BACAN BclA protein OS=Bacillus anthracis GN=bclA PE=1 SV=1 MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGP TGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGD TGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGP TGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGP TGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETG FYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVI VTGLGLSLALGTSASIIIEKVA
Sequence length 382 AA
Subcellular LocationSurface
Function It is the major glycoprotein of exosporium and also the immunodominant protein of the spore surface. Exosporium is a loose fitting layer enclosing the spore. BclA forms the filaments of the external hair-like nap of the exosporium.
Protein Structure
PDB ID 2R6Q
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionECL Glycoprotein detection kit and chemical deglycosylation using trifluoromethanesulfonic acid (TFMS).
Glycan Information
Glycan Annotation The protein is extensively O-glycosylated with a 715-Da tetrasaccharide and a 324-Da disaccharide. The tetrasaccharide contains three rhamnose residues and an unusual terminal sugar, 2-O-methyl-4- (3-hydroxy-3-methylbutanamido)-4,6-dideoxy-D-glucopyranose, named anthrose (Ant). The tetrasaccharide has the structure: β-Ant-(1→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→2)-L-Rhap. Oligosaccharide is attached to the BclA through a GalNAc linker. In its absence, GlcNAc can serve as a substitute linker.
BCSDB ID23688
Literature
Year of Identification2002
Year of Identification Month Wise2002.7
ReferenceOberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Moller, H.M., Pluschke, G. and Seeberger, P.H. (2010) Molecular analysis of carbohydrate-antibody interactions: case study using a Bacillus anthracis tetrasaccharide. J Am Chem Soc, 132, 10239-10241. [PubMed: 20614885]
Author Oberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Moller, H.M., Pluschke, G. Seeberger, P.H.
Research GroupDepartment of Biomolecular Systems, Max-Planck Institute for Colloids and Interfaces, 14476 Potsdam, Germany.
Corresponding Author Seeberger, P.H.
ContactDepartment of Biomolecular Systems, Max-Planck Institute for Colloids and Interfaces, 14476 Potsdam, Germany.
ReferenceTamborrini, M., Holzer, M., Seeberger, P.H., Schurch, N. and Pluschke, G. (2010) Anthrax spore detection by a luminex assay based on monoclonal antibodies that recognize anthrose-containing oligosaccharides. Clin Vaccine Immunol, 17, 1446-1451. [PubMed: 20660139]
AuthorTamborrini, M., Holzer, M., Seeberger, P.H., Schurch, N. Pluschke, G.
Research GroupSwiss Tropical and Public Health Institute, Socinstr. 57, CH 4002 Basel, Switzerland
Corresponding Author Pluschke, G.
ContactSwiss Tropical and Public Health Institute, Socinstr. 57, CH 4002 Basel, Switzerland
ReferenceDong, S., Chesnokova, O.N., Turnbough, C.L., Jr. and Pritchard, D.G. (2009) Identification of the UDP-N-acetylglucosamine 4-epimerase involved in exosporium protein glycosylation in Bacillus anthracis. J Bacteriol, 191, 7094-7101.
AuthorDong, S., Chesnokova, O.N., Turnbough, C.L., Jr. Pritchard, D.G.
Research GroupDepartment of Biochemistry and Molecular Genetics, University of Alabama at Birmingham, Birmingham, AL 35294-2170, USA.
Corresponding Author Pritchard, D.G.
ContactDepartment of Biochemistry and Molecular Genetics, University of Alabama at Birmingham, Birmingham, AL 35294-2170, USA.
ReferenceSaksena, R., Adamo, R. and Kovac, P. (2006) Synthesis of the tetrasaccharide side chain of the major glycoprotein of the Bacillus anthracis exosporium. Bioorg Med Chem Lett, 16, 615-617. [PubMed: 16275067]
Author Saksena, R., Adamo, R. and Kovac, P
Research GroupNational Institute of Diabetes and Digestive and Kidney Disease/LMC, National Institutes of Health, Bethesda, MD 20892-0815, USA.
Corresponding Author Kovac, P
ContactNational Institute of Diabetes and Digestive and Kidney Disease/LMC, National Institutes of Health, Bethesda, MD 20892-0815, USA.