ProGP225

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP225
Validation Status Uncharacterized
Organism Information
Organism NamePseudomonas syringae pv. tomato str. DC3000
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 223283
Genome Sequence(s)
GenBank AE016853.1
EMBL AE016853
Organism Additional Information Pseudomonas syringae (Gram-negative bacterium) is phytopathogenic.
Gene Information
Gene NamefliC (PSPTO1949)
NCBI Gene ID 1183594
Protein Information
Protein NameFlagellin
UniProtKB/SwissProt ID Q884Y7
NCBI RefSeq NP_791772.1
EMBL-CDSAAO55467.1
UniProtKB Sequence >tr|Q884Y7|Q884Y7_PSESM Flagellin OS=Pseudomonas syringae pv. tomato str. DC3000 GN=fliC PE=4 SV=1 MALTVNTNVASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRG QTMAIKNANDGMSLAQTAEGALQESTNILQRMRELAVQSRNDSNSATDREALNKEFTAMS SELTRIAQSTNLNGKNLLDGSASTMTFQVGSNSGASNQISLTLSASFDANTLGVGSAISI TGADSATSEAAFSAAVAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENASAALGR VQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ
Sequence length 282 AA
Subcellular LocationFlagellum
Function Structural subunit of flagellum. It plays a role in the induction of hypersensitive cell death in its non-host tobacco plants.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionChemical deglycosylation with anhydrous trifluoromethanesulfonic acid (TFMS) and glycoprotein staining (using GelCode kit)
Literature
Year of Identification2003
Year of Identification Month Wise2003.1
ReferenceTaguchi, F., Shimizu, R., Inagaki, Y., Toyoda, K., Shiraishi, T. and Ichinose, Y. (2003) Post-translational modification of flagellin determines the specificity of HR induction. Plant Cell Physiol, 44, 342-349. [PubMed: 12668781]
Author Taguchi, F., Shimizu, R., Inagaki, Y., Toyoda, K., Shiraishi, T. Ichinose, Y.
Research GroupLaboratory of Plant Pathology & Genetic Engineering, Faculty of Agriculture, Okayama University, Tsushima-naka 1-1-1, Okayama, 700-8530 Japan.
Corresponding Author Ichinose, Y.
ContactLaboratory of Plant Pathology & Genetic Engineering, Faculty of Agriculture, Okayama University, Tsushima-naka 1-1-1, Okayama, 700-8530 Japan.