ProGP255

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP255
Validation Status Uncharacterized
Organism Information
Organism NameSalmonella enterica serovar Typhimurium
Domain Bacteria
Classification Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 90371
Genome Sequence(s)
GenBank AE006468.1
EMBL AE006468
Gene Information
Gene Namedps (STM0831)
NCBI Gene ID 1252350
Protein Information
Protein NameDps (18 kDa), Stress inducible DNA binding protein
UniProtKB/SwissProt ID Q7CQV9
NCBI RefSeq NP_459808.1
EMBL-CDSAAL19767.1
UniProtKB Sequence >sp|Q7CQV9|DPS_SALTY DNA protection during starvation protein OS=Salmonella typhimurium GN=dps PE=3 SV=3 MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFI AVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKE LADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
Sequence length 167 AA
Subcellular LocationIntracellular
Function Dps is a protein that is produced in large amounts when the bacterial cell faces harm (starvation), which results in DNA protection (DNA biocrystallization). Glycosylated Dps is produced in the pre- and early stationary phases of bacterial growth.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPAS-staining and enzyme-linked lectin assay (jacalin, conA, KM+)
Glycan Information
Glycan Annotation Mannose, glucose, and an unknown sugar residue.
Literature
Year of Identification2007
Year of Identification Month Wise2007.04
ReferenceHanna, E.S., Roque-Barreira, M.C., Bernardes, E.S., Panunto-Castelo, A., Sousa, M.V., Almeida, I.C. and Brocchi, M. (2007) Evidence for glycosylation on a DNA-binding protein of Salmonella enterica. Microb Cell Fact, 6, 11. [PubMed: 17407574]
Author Brocchi, M.
Research GroupDepartment of Cellular and Molecular Biology and Pathogenic Bioagents, School of Medicine of Ribeirão Preto, University of São Paulo, Av, Bandeirantes 3900, Ribeirão Preto, SP 14049-900, Brazil.
Corresponding Author Hanna, E.S., Roque-Barreira, M.C., Bernardes, E.S., Panunto-Castelo, A., Sousa, M.V., Almeida, I.C. Brocchi, M.
ContactDepartment of Cellular and Molecular Biology and Pathogenic Bioagents, School of Medicine of Ribeirão Preto, University of São Paulo, Av, Bandeirantes 3900, Ribeirão Preto, SP 14049-900, Brazil.