ProGP256

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP256
Validation Status Characterized
Organism Information
Organism NameDesulfovibrio gigas
Domain Bacteria
Classification Family: Desulfovibrionaceae
Order: Desulfovibrionales
Class: Deltaproteobacteria or Deltabacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 879
Genome Sequence(s)
GenBank AJ318781 
EMBL AJ318781 
Gene Information
Gene NamehcgA
GenBank Gene Sequence CP006585.1
Protein Information
Protein NameHmcA
UniProtKB/SwissProt ID T2G9Q2
NCBI RefSeq AGW12617.1
EMBL-CDSAGW12617.1
UniProtKB Sequence >tr|T2G9Q2|T2G9Q2_DESGI Sixteen Heme Cytochrome OS=Desulfovibrio gigas DSM 1382 = ATCC 19364 GN=hmcA PE=1 SV=1 MTQRKRAARWVGIPCAILFLTVPFISATASTPGPASTAEPKVDAIVIDTAAVFGKLEQPG VVFYHEKHTTALEKMAKDCTSCHVETEGKLSFKFARTVDPTSKNAMAEQYHANCMACHEK VVGSYPTAPQAAECKRCHVGPGVEGATVTPKPSLDLNLHGRHVVAEAKRLQVKEDESCKA CHHTYDEAQKKLVYAKGEEGSCVYCHKQEPLPSPVQQDRVVPSTRDASHESCVNCHLSTR KAQTESGPVLCVGCHTAEAQAAWKKTAETPRLFRGQPDATLLVAGAATANGTVDVNWAAA GPGPVAFDHKAHEGFVGNCVTCHHPTQTGGSLAACGVACHTTTGSKDGNFVTTAQSAHQL GVTTSCVGCHTTQANARKECAGCHAPMQKTALSQNSCIQCHEAGFPTSGTQTLGKEEREA TAAKILAAKDEKPKTVPLENVPEKLTLNYMDEKGDEWQAAEFPHRKIYQKLVEEAAKSPM ANHFHGDALTMCSGCHHNAKPSLNPPKCASCHSKPFQERTANQPGLKGAFHNQCIGCHQE MQVNPKATDCQGCHKPKNS
Sequence length 559 AA
Subcellular LocationPeriplasm
Function A high molecular mass cytochrome that harbours 16 c-type heme groups. Involved in electron transfer from the periplasm to the cytoplasm. The high molecular mass complex Hmc (HmcA–HmcF) from Desulfovibrio sp. has been proposed to be involved in the bridge between periplasmic hydrogen oxidation and cytoplasmic sulphate reduction in Desulfovibrio gigas.
Protein Structure
PDB ID 1Z1N
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN290 (N261 position in the crystal structure corresponds to the N290 in full length protein sequence)
Experimentally Validated Glycosite(s ) in Mature ProteinN290
Glycosite(s) Annotated Protein Sequence >1Z1N:X|PDBID|CHAIN|SEQUENCE MTQRKRAARWVGIPCAILFLTVPFISATASTPGPASTAEPKVDAIVIDTAAVFGKLEQPGVVFYHEKHTTALEKMAKDCT SCHVETEGKLSFKFARTVDPTSKNAMAEQYHANCMACHEKVVGSYPTAPQAAECKRCHVGPGVEGATVTPKPSLDLNLHG RHVVAEAKRLQVKEDESCKACHHTYDEAQKKLVYAKGEEGSCVYCHKQEPLPSPVQQDRVVPSTRDASHESCVNCHLSTR KAQTESGPVLCVGCHTAEAQAAWKKTAETPRLFRGQPDATLLVAGAATAN*(290)GTVDVNWAAAGPGPVAFDHKAHEGFVGNCV TCHHPTQTGGSLAACGVACHTTTGSKDGNFVTTAQSAHQLGVTTSCVGCHTTQANARKECAGCHAPMQKTALSQNSCIQC HEAGFPTSGTQTLGKEEREATAAKILAAKDEKPKTVPLENVPEKLTLNYMDEKGDEWQAAEFPHRKIYQKLVEEAAKSPM ANHFHGDALTMCSGCHHNAKPSLNPPKCASCHSKPFQERTANQPGLKGAFHNQCIGCHQEMQVNPKATDCQGCHKPKNSA
Sequence Around Glycosites (21 AA) TLLVAGAATANGTVDVNWAAA
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionCrystallographic analysis (electron density maps), GlycoProfile III carbohydrate detection kit (using periodic acid as oxidizing agent), MALDI-TOF(matrix-assisted laser desorption/ionization time-of-flight)
Technique(s) used for Glycosylated Residue(s) Detection Crystallographic analysis (electron density maps)
Protein Glycosylation- Implication Carbohydrate could be acting as an anchor of the protein to the phospholipidic membrane. The carbohydrate bound to HmcA may also contribute to the maintenance of the protein conformation and stability as well as to a protection mechanism against proteases.
Glycan Information
Glycan Annotation Trisaccharide (NAG,NAA,any epimer of NAG); AllNacGlcNAc-Asn linkage; NAA is (epimer of NAG) N-acetylallosamine.
Technique(s) used for Glycan Identification Crystallographic analysis (electron density maps)
Literature
Year of Identification2007
Year of Identification Month Wise2007.07
Year of Validation 2007
ReferenceSantos-Silva, T., Dias, J.M., Dolla, A., Durand, M.C., Goncalves, L.L., Lampreia, J., Moura, I. and Romao, M.J. (2007) Crystal structure of the 16 heme cytochrome from Desulfovibrio gigas: a glycosylated protein in a sulphate-reducing bacterium. J Mol Biol, 370, 659-673. [PubMed: 17531266]
AuthorSantos-Silva, T., Dias, J.M., Dolla, A., Durand, M.C., Goncalves, L.L., Lampreia, J., Moura, I. and Romao, M.J.
Research GroupREQUIMTE, CQFB, Department of Chemistry, FCT-UNL, 2829-516 Caparica, Portugal.
Corresponding Author Romao, M.J.
ContactREQUIMTE, CQFB, Department of Chemistry, FCT-UNL, 2829-516 Caparica, Portugal.