ProGP259

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP259
Validation Status Characterized
Organism Information
Organism NameMethanococcus maripaludis S2
Domain Archaea
Classification Family: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 39152
Genome Sequence(s)
GenBank AF333233
EMBL AF333233
Gene Information
Gene NameflaB1
Protein Information
Protein NameFlaB1
UniProtKB/SwissProt ID Q9C4R3
EMBL-CDSAAG50057.1
UniProtKB Sequence >tr|Q9C4R3|Q9C4R3_METMP FlaB1 OS=Methanococcus maripaludis GN=flaB1 PE=4 SV=1 MKIKEFLKTKKGASGIGTLIVFIAMVLVAAVAASVLINTSGFLQQKASTTGKESTEQVAS GLLLNGITGSVGTSDVKLLAIYLCPNAGSSAIDLAQTKIMLDYDGKSVVLGYGGNQDMSS GNSSVFSNDTGATATTFQVNILQDYDDSAVDNAVINKGDAVALIVDVNASFGGEIPERTA ISGKVQPEFGAPGVISFTTPASYTTALVELQ
Sequence length 211 AA
Subcellular LocationSurface
Function Flagellin
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-12) N122, N128, N168
Experimentally Validated Glycosite(s ) in Mature ProteinN110, N116, N156
Glycosite(s) Annotated Protein Sequence >tr|Q9C4R3|Q9C4R3_METMP FlaB1 OS=Methanococcus maripaludis GN=flaB1 PE=4 SV=1 MKIKEFLKTKKGASGIGTLIVFIAMVLVAAVAASVLINTSGFLQQKASTTGKESTEQVAS GLLLNGITGSVGTSDVKLLAIYLCPNAGSSAIDLAQTKIMLDYDGKSVVLGYGGNQDMSS GN*(122)SSVFSN*(128)DTGATATTFQVNILQDYDDSAVDNAVINKGDAVALIVDVN*(168)ASFGGEIPERTA ISGKVQPEFGAPGVISFTTPASYTTALVELQ
Sequence Around Glycosites (21 AA) YGGNQDMSSGNSSVFSNDTGA
MSSGNSSVFSNDTGATATTFQ
GDAVALIVDVNASFGGEIPER
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionAberrant SDS-PAGE migration and glycan detection by MS
Technique(s) used for Glycosylated Residue(s) Detection NanoLC–MS/MS (nano-liquid chromatography-electrospray tandem mass spectrometry)
Protein Glycosylation- Implication Glycan is necessary for proper flagellar filament assembly and function. A minimal portion of the glycan (at least two sugars) is required to facilitate flagellar assembly and the presence of each additional sugar results in increased motility, as measured on semi-swarm plates.
Glycan Information
Glycan Annotation Linkage: β-GalNAc-Asn.
N-linked tetrasaccharide (1036.4 Da) composed of N-acetylgalactosamine, di-acetylated glucuronic acid, an acetylated and acetamidino-modified mannuronic acid linked to threonine, and a novel terminal sugar: Sug-4-β-ManNAc3NAmA6Thr-4-β-GlcNAc3NAcA-3-β-GalNAc-Asn where Sug is a novel monosaccharide unit, (5S)-2-acetamido-2,4-dideoxy-5-O-methyl-α-L-erythro-hexos-5-ulo-1,5-pyranose,.
BCSDB ID23737
Technique(s) used for Glycan Identification NanoLC–MS/MS analysis and 1H, 13C NMR spectroscopy
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameAglB/STT3 subunit
OST ProGT IDProGT11
Characterized Accessory Gene(s)AglO, AglA, AglL are glycosyltransferases responsible for tetrasaccharide assembly. AglO adds the second sugar, AglA adds the third sugar, and AglL transfers the last sugar. MMP0350 (acetyltransferase-second sugar ), MMP1081 (Acetamidino transfer-third sugar), MMP1085 (Methyltransferase-fourth sugar). MMP1081 and MMP1085 are unpublished results as referred in ref 4.
Characterized by gene deletion studies
Accessory Gene(s)Progt IDProGT11.1-ProGT11.19
Additional CommentSug, a novel monosaccharide unit, (5S)-2-acetamido-2,4-dideoxy-5-O-methyl-α-L-erythro-hexos-5-ulo-1,5-pyranose is the first example of a naturally occuring diglycoside of an aldulose.
Literature
Year of Identification2008
Year of Identification Month Wise2008.10.1
Year of Validation 2009
ReferenceJarrell, K.F., Jones, G.M. and Nair, D.B. Biosynthesis and role of N-linked glycosylation in cell surface structures of archaea with a focus on flagella and s layers. Int J Microbiol, 2010, 470138. [PubMed: 20721273]
AuthorJarrell, K.F., Jones, G.M. and Nair, D.B.
Research GroupDepartment of Microbiology and Immunology, Queens University, Kingston, ON, Canada
Corresponding Author Nair, D.B.
ContactDepartment of Microbiology and Immunology, Queens University, Kingston, ON, Canada
Reference Kelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E. (2009) A novel N-linked flagellar glycan from Methanococcus maripaludis. Carbohydr Res, 344, 648-653. [PubMed: 19203750]
Author Kelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E.
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
Corresponding Author Vinogradov, E.
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
ReferenceKelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E. (2009) A novel N-linked flagellar glycan from Methanococcus maripaludis. Carbohydr Res, 344, 648-653. [PubMed: 19203750]
Author Kelly, J., Logan, S.M., Jarrell, K.F., V yke, D.J.
Research GroupInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
Corresponding Author yke, D.J.
ContactInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada K1A 0R6.
ReferenceVanDyke, D.J., Wu, J., Logan, S.M., Kelly, J.F., Mizuno, S., Aizawa, S. and Jarrell, K.F. (2009) Identification of genes involved in the assembly and attachment of a novel flagellin N-linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Mol Microbiol, 72, 633-644. [PubMed: 19400781]
Author VanDyke, D.J., Wu, J., Logan, S.M., Kelly, J.F., Mizuno, S., Aizawa, S. and Jarrell, K.F
Research GroupDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K.F.
ContactDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Reference VanDyke, D.J., Wu, J., Ng, S.Y., Kanbe, M., Chaban, B., Aizawa, S. and Jarrell, K.F. (2008) Identification of a putative acetyltransferase gene, MMP0350, which affects proper assembly of both flagella and pili in the archaeon Methanococcus maripaludis. J Bacteriol, 190, 5300-5307. [PubMed: 18539748]
Author VanDyke, D.J., Wu, J., Ng, S.Y., Kanbe, M., Chaban, B., Aizawa, S. and Jarrell, K.F.
Research GroupDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K.F.
ContactDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.