ProGP261

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP261
Validation Status Characterized
Organism Information
Organism NameClostridium botulinum F str. Langeland/ A str. FE9909ACS Alberta
Domain Bacteria
Classification Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 441772
Genome Sequence(s)
GenBank CP000728.1
EMBL CP000728
Organism Additional Information Clostridium botulinum is a Gram-positive spore-forming anaerobic bacterium that causes botulism. Botulism is a descending symmetrical paralysis caused by botulinum neurotoxin (BoNT). Regarding the way of its entrance into the body, it can lead to infant/adult intestinal toxaemia, wound botulism, or food-borne botulism.
Gene Information
Gene NameflaA (CLI_2781)
NCBI Gene ID 5404818
GenBank Gene Sequence 5404818
Protein Information
Protein NameFlagellin (FlaA)
UniProtKB/SwissProt ID A7GGU9
NCBI RefSeq YP_001392009.1
EMBL-CDSABS41149.1
UniProtKB Sequence >tr|A7GGU9|A7GGU9_CLOBL Flagellin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=CLI_2781 PE=4 SV=1 MIINHNLNAMNAHRQMAINTGSNGKAIEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLN QASRNSQDSISLIQTAEGALNETHSILQRMRELAVQSANDTNVKVDRDNLQKEVAELQNE INRIASQTQFNTKNLLNGSAKSMVFQIGANKDQVMELTIAGMGTSALKVGSINIGSGKGA KSISGMIETIDNAINTVSGERAKLGANQNRLEHTIANLDNSAENLQAAESRIRDVDMAKE MMNFTKTNILTQAAQAMLAQANQAPQGVLQLLR
Sequence length 273 AA
Subcellular LocationSurface
Function Forms the filaments of bacterial flagella.
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS126, S139, S142, S165, S171, S176, S182
Experimentally Validated Glycosite(s ) in Mature ProteinS126, S139, S142, S165, S171, S176, S182
Glycosite(s) Annotated Protein Sequence >tr|A7GGU9|A7GGU9_CLOBL Flagellin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=CLI_2781 PE=4 SV=1 MIINHNLNAMNAHRQMAINTGSNGKAIEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLN QASRNSQDSISLIQTAEGALNETHSILQRMRELAVQSANDTNVKVDRDNLQKEVAELQNE INRIAS*(126)QTQFNTKNLLNGS*(139)AKS*(142)MVFQIGANKDQVMELTIAGMGTS*(165)ALKVGS*(171)INIGS*(176)GKGA KS*(182)ISGMIETIDNAINTVSGERAKLGANQNRLEHTIANLDNSAENLQAAESRIRDVDMAKE MMNFTKTNILTQAAQAMLAQANQAPQGVLQLLR
Sequence Around Glycosites (21 AA) ELQNEINRIASQTQFNTKNLL
QFNTKNLLNGSAKSMVFQIGA
TKNLLNGSAKSMVFQIGANKD
MELTIAGMGTSALKVGSINIG
GMGTSALKVGSINIGSGKGAK
ALKVGSINIGSGKGAKSISGM
INIGSGKGAKSISGMIETIDN
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass spectrometry
Technique(s) used for Glycosylated Residue(s) Detection Electron transfer dissociation (ETD) MS with and without collision-activated dissociation (CAD).
Glycan Information
Glycan Annotation A novel legionaminic acid derivative (417 Da), 7-acetamido-5-(N-methyl-glutam-4-yl)-amino-3,5,7,9-tetradeoxy-D-glycero-α-D-galacto-nonulosonic acid, (αLeg5GluNMe7Ac).
BCSDB ID22742
Technique(s) used for Glycan Identification Homonuclear and heteronuclear 1H, 13C-NMR spectra, selective TOCSY (total correlation spectroscopy), HSQC (heteronuclear single quantum coherence), HMBC (heteronuclear multiple bond coherence).
Literature
Year of Identification2008
Year of Identification Month Wise2009.11.1
Year of Validation 2008
ReferenceTwine, S.M., Paul, C.J., Vinogradov, E., McNally, D.J., Brisson, J.R., Mullen, J.A., McMullin, D.R., Jarrell, H.C., Austin, J.W., Kelly, J.F. et al. (2008) Flagellar glycosylation in Clostridium botulinum. FEBS J, 275, 4428-4444. [PubMed: 18671733]
Author Twine, S.M., Paul, C.J., Vinogradov, E., McNally, D.J., Brisson, J.R., Mullen, J.A., McMullin, D.R., Jarrell, H.C., Austin, J.W., Kelly, J.F. et al.
Research GroupNRC-Institute for Biological Sciences, Ottawa, Canada.
Corresponding Author Kelly, J.F
ContactNRC-Institute for Biological Sciences, Ottawa, Canada.