ProGP267

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP267
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842579.1
EMBL BX842579
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameggtB (Rv2394)
NCBI Gene ID 885867
Protein Information
Protein NameGgtB
UniProtKB/SwissProt ID P71750
NCBI RefSeq NP_216910.1
EMBL-CDSCAB03749.1
UniProtKB Sequence >tr|P71750|P71750_MYCTU Gamma-glutamyltransferase OS=Mycobacterium tuberculosis GN=ggtB PE=4 SV=2 MSVWLRAGALVAAVMLSLSGCGGFHAGAPSTAGPCEIVPNGTPAPKTPPATVPSSRNLAT NPEIATGYRRDMTVVRTAHYAAATANPLATQVACRVLRDGGTAADAVVAAQAVLGLVEPQ SSGIGGGGYLVYFDARTGSVQAYDGREVAPAAATENYLRWVSDVDRSAPRPNARASGRSI GVPGILRMLEMVHNEHGRTPWRDLFGPAVTLADGGFDISARMGAAISDAAPQLRDDPEAR KYFLNPDGSPKPAGTRLTNPAYSKTLSAIASAGANAFYSGDIAHDIVAAASDTSNGRTPG LLTIEDLAGYLAKRRQPLCTTYRGREICGMPSSGGVAVAATLGILEHFPMSDYAPSKVDL NGGRPTVMGVHLIAEAERLAYADRDQYIADVDFVRLPGGSLTTLVDPGYLAARAALISPQ HSMGSARPGDFGAPTAVAPPVPEHGTSHLSVVDSYGNAATLTTTVESSFGSYHLVDGFIL NNQLSDFSAEPHATDGSPVANRVEPGKRPRSSMAPTLVFDHSSAGRGALYAVLGSPGGSM IIQFVVKTLVAMLDWGLNPQQAVSLVDFGAANSPHTNLGGENPEINTSDDGDHDPLVQGL RALGHRVNLAEQSSGLSAITRSEAGWAGGADPRREGAVMGDDA
Sequence length 643 AA
Subcellular LocationSecretory and cell surface
Function Gamma-glutamyltransferase or gamma-glutamyltranspeptidase (EC=2.3.2.2).
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT51, S54 and S55
Glycosite(s) Annotated Protein Sequence >tr|P71750|P71750_MYCTU Gamma-glutamyltransferase OS=Mycobacterium tuberculosis GN=ggtB PE=4 SV=2 MSVWLRAGALVAAVMLSLSGCGGFHAGAPSTAGPCEIVPNGTPAPKTPPAT*(51)VPS*(54)S*(55)RNLAT NPEIATGYRRDMTVVRTAHYAAATANPLATQVACRVLRDGGTAADAVVAAQAVLGLVEPQ SSGIGGGGYLVYFDARTGSVQAYDGREVAPAAATENYLRWVSDVDRSAPRPNARASGRSI GVPGILRMLEMVHNEHGRTPWRDLFGPAVTLADGGFDISARMGAAISDAAPQLRDDPEAR KYFLNPDGSPKPAGTRLTNPAYSKTLSAIASAGANAFYSGDIAHDIVAAASDTSNGRTPG LLTIEDLAGYLAKRRQPLCTTYRGREICGMPSSGGVAVAATLGILEHFPMSDYAPSKVDL NGGRPTVMGVHLIAEAERLAYADRDQYIADVDFVRLPGGSLTTLVDPGYLAARAALISPQ HSMGSARPGDFGAPTAVAPPVPEHGTSHLSVVDSYGNAATLTTTVESSFGSYHLVDGFIL NNQLSDFSAEPHATDGSPVANRVEPGKRPRSSMAPTLVFDHSSAGRGALYAVLGSPGGSM IIQFVVKTLVAMLDWGLNPQQAVSLVDFGAANSPHTNLGGENPEINTSDDGDHDPLVQGL RALGHRVNLAEQSSGLSAITRSEAGWAGGADPRREGAVMGDDA
Sequence Around Glycosites (21 AA) GTPAPKTPPATVPSSRNLATN
APKTPPATVPSSRNLATNPEI
PKTPPATVPSSRNLATNPEIA
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.02
ReferenceGonzález-Zamorano M1, Mendoza-Hernández G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C (2009) .Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.J Proteome Res. 2009 Feb;8(2):721-33. doi: 10.1021/pr800756a
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
ReferenceSmith GT, Sweredoski MJ, Hess S.(2013) O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins. J Proteomics. 2014 Jan 31;97:296-306. doi: 10.1016/j.jprot.2013.05.011. Epub 2013 May 20.
AuthorSmith GT, Sweredoski MJ, Hess S.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA.
Corresponding Author Hess S.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA.