ProGP269

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP269
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842573.1
EMBL BX842573
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv0315
NCBI Gene ID 886563
Protein Information
Protein NameBglu
UniProtKB/SwissProt ID O07242
NCBI RefSeq NP_214829.1
EMBL-CDSCAB09586.1
UniProtKB Sequence >tr|O07242|O07242_MYCTU POSSIBLE BETA-1,3-GLUCANASE OS=Mycobacterium tuberculosis GN=Rv0315 PE=4 SV=1 MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPAPAAPAAATGGLLFHD EFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQNVFLDGNSNLVLRATR EGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSNDDPGRSGEIDLIEWYGN GTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMYFWLDYADGIEPYFSVPAT GIEDLNEPIREWPFNDPGYKVFPVLNLAVGGSGGGDPATGSYPQEMLVDWVRVF
Sequence length 294 AA
Function Beta-1,3-glucanase precursor.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.