ProGP27

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP27
Validation Status Uncharacterized
Organism Information
Organism NameCellulomonas fimi ATCC 484
Domain Bacteria
Classification Family: Cellulomonadaceae
Suborder: Micrococcineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1708
Genome Sequence(s)
GenBank M15824
EMBL M15824
Gene Information
Gene Namecex
Protein Information
Protein NameCex (Exoglucanase or xylanase)
UniProtKB/SwissProt ID P07986
EMBL-CDSAAA56791.1
UniProtKB Sequence >sp|P07986|GUX_CELFI Exoglucanase/xylanase OS=Cellulomonas fimi GN=cex PE=1 SV=1 MPRTTPAPGHPARGARTALRTTRRRAATLVVGATVVLPAQAATTLKEAADGAGRDFGFAL DPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYG HTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGDGPPQDS AFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDC VGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQ ACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGASPTPT PTTPTPTPTTPTPTPTSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPS GQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTP CTVG
Sequence length 484 AA
Function β-1,4-xylanase (exo-β-1,4-glucanase). Involved in cellulose hydrolysis.
Glycosylation Status
Glycosylation Type O- (Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPAS-staining and ConA binding
Glycan Information
Glycan Annotation Linkage: Man-O-Thr, Gal-O-Thr. Terminal α-mannosyl residues with proximal α-galactosyl residues are attached to the T residues. Glucose is also present.
Literature
Year of Identification1984
Year of Identification Month Wise1984.8
ReferenceOng, E., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1994) Streptomyces lividans glycosylates the linker region of a beta-1,4-glycanase from Cellulomonas fimi. J Bacteriol, 176, 999-1008. [PubMed: 8106343]
Author Ong, E., Kilburn, D.G., Miller, R.C., Jr. Warren, R.A.
Research GroupDepartment of Microbiology and Immunology, University of British Columbia, Vancouver, Canada.
Corresponding Author Warren, R.A.
ContactDepartment of Microbiology and Immunology, University of British Columbia, Vancouver, Canada.
ReferenceGilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1984) Mode of action and substrate specificities of cellulases from cloned bacterial genes. J Biol Chem, 259, 10455-10459. [PubMed: 6432782]
AuthorGilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. Warren, R.A.
Research GroupDepartment of Microbwbgy, University of British Columbia, Vancouver, British Columbia, Cada
Corresponding Author Warren, R.A.
ContactDepartment of Microbwbgy, University of British Columbia, Vancouver, British Columbia, Cada