ProGP276

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP276
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842583.1
EMBL BX842583
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelpqF (Rv3593)
NCBI Gene ID 886290
Protein Information
Protein NameLpqF lipoprotein
UniProtKB/SwissProt ID O06155
NCBI RefSeq NP_218110.1
EMBL-CDSCAB08910.1
UniProtKB Sequence >tr|O06155|O06155_MYCTU PROBABLE CONSERVED LIPOPROTEIN LPQF OS=Mycobacterium tuberculosis GN=lpqF PE=4 SV=2 MGPARLHNRRAGRRMLALSAAAALIVALASGCSSAPTPSANAANHGHRIDTRTPPGLRAQ QTMDMLNSDWPIGEIGVGTLAAPGQVDTVKTTMEALWWDRPFALAGVDIGASVAALHLIS SYGAQQDIRIHTDDDGWVDRFDVETQAPSIASWRDVDAALSKTGARYSFQVAKVDNGRCD PVAGTNTGESLPLASIFKLYVLHALAGAVQHNTVSWDDLLTVTAKSKAVGSSGLELPVGA RVSVRTAAEKMIATSDNMATDLLIERLGTRAIEEALASAGHHDPASMTPFPTMYELFSVG WGKPDLRDQWKHATQQVRAQILRQTNSTPYQPDPTRAHTPASNYGAEWYGSAEDICRVHA ALRADAVGPASPVRQIMSAVPGIQLDRSVWPYIGAKAGGLPGDLTFSWYAVDKTGQPWVV SFQLNWPRDHGPTVTGWMLQVARQVFALIAPQ
Sequence length 452 AA
Function Lipoprotein
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.