ProGP291

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP291
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv0988
NCBI Gene ID 885353
Protein Information
Protein NameRv0988
UniProtKB/SwissProt ID O86370
NCBI RefSeq NP_215503.1
EMBL-CDSCAA17587.1
UniProtKB Sequence >tr|O86370|O86370_MYCTU POSSIBLE CONSERVED EXPORTED PROTEIN OS=Mycobacterium tuberculosis GN=MT1017 PE=4 SV=1 MRKAGLTGVVLVLTLTLVAFWWWQRPRTNAVAADSLVGVLVDENNAGYSLATVPGAVRFP RDLGPHYDYQTEWWYYTGNLETADGRLFGYQLTFFRRALAPPGEGVAIADASSWRTTQVY MAHFAISDISNRGFYPAEKFSRQALGLAGASSEPYAVWLDDWYARESNNNSVQLFARTQN TVLDLTLTQTLPPILQGNAGLSVKGAQPGNASNYYSLVRQESRGTVSVNGDTFMVSGLSW KDHEYMTSALAPEDVGWDWFGLQFYNGTALMLFQIRQADGSVTRFSSGTFVAGDGGVIPL ESSDFRIKTTDRWTSDQSGATYPIAWEIEIERIGLTLRGAALMANQELRLSRTYWEGAVA LEGRYQGMPISGRGYVEMTGYVQRLS
Sequence length 386 AA
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.