ProGP292

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP292
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv1084
NCBI Gene ID 887098
Protein Information
Protein NameRv1084
UniProtKB/SwissProt ID O53432
NCBI RefSeq NP_215600.1
EMBL-CDSCAA17200.1
UniProtKB Sequence >tr|O53432|O53432_MYCTU Putative uncharacterized protein OS=Mycobacterium tuberculosis GN=MT1115 PE=4 SV=1 MSPANPSGTNTLALATSPYLRQHADNPVHWQQWTPQALAEAAARAVPILLSVGYAACHWC HVMAHESFDDDEVAAAMNAGFVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPN GRPFFCGTYYPKAAFLQLLSAISETWRERRAEVEQASDHIAAELRSMASGLPGGGPEVAP ELCDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYERTRSPAALEAVARTGNAMA RGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTA RFLLDELGSKAPADMFTSSLDADADGREGSTYVWTPVQLTEVLGGDDGRWAAEVFGVTEA GTFEHGTSVLQLPADPDDAARLDRVRAALLVARLARAQPARDDKVVTSWNGLAITALAEA SVALDDPALAHAARRCATRLLDLHVVDGRLRRASLGGVVGDSAAILEDHAMLATGLLALY QLTSEGAWLTAATGLLDTAVAHFGDPQRPGRWFDTADDAERLMLRPSDPLDGATPSGASS IAEALLTAGHVVDGARAERYWQLAADTLRAHAVLLARAPRSAGHWLAVAEAVVRGPLQIA VACDLPRSSLLADARRLAPGGAIVVGGAAGSSALLVGRDRVAGADAAYVCRGRVCDLPVT SAAELATALGVPG
Sequence length 673 AA
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.