ProGP294

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP294
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842580.1
EMBL BX842580 
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv2672
NCBI Gene ID 887398
Protein Information
Protein NameSecreted protease
UniProtKB/SwissProt ID P71969
NCBI RefSeq NP_217188.1 
EMBL-CDSCAB02326.1
UniProtKB Sequence >tr|P71969|P71969_MYCTU POSSIBLE SECRETED PROTEASE OS=Mycobacterium tuberculosis GN=Rv2672 PE=4 SV=1 MATVVGMSRPMTSTAMLVALTCSATVLAACVPAFGADPRFATYSGAGPQGAATTTPPPAG PPPLAAPKNDLSWHDCTSRVYSNAGIPAAPGVKLECASYDTDLDPLVGGSTAVSIGVVRA RSNQTPSDAGPLVFTTGSDLPSSTQLPVWLAHAGIDVLRSHPIVAVDRRGMGMSSPIDCR DHFDRDEMRDQAQFQAGDDPVANLSDISNTATTDCTDAIAPGESAYDNTHAASDIERLRK LWDVPALAFVGIGNGTQVALAYAASRPDNVARLILDSPIALGVSAEAAAEQQVQGQQAAL DAFAAQCVAVNCALGSHPKGAVSALLSAARSGDGPGGASVAAVANAVATALGFPDSGRVD STTKLADALAAARSGDMNLLSALINRADTTRDTDGQFISSCSDAVNRPTPDRVRELVVAW GKLYPQFGAVAALNLVKCVHWPSSSPPQPPKDLKVDVLLLGVQNDPIVGNEGVAATAATA INANAASKRVMWQGIGHGASIYSSCAVPPLVAYLDTGKLPDTDTYCPA
Sequence length 528 AA
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.