ProGP318

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP318
Validation Status Uncharacterized
Organism Information
Organism NameBacteroides fragilis
Domain Bacteria
Classification Family: Bacteroidaceae
Order: "Bacteroidales"
Class: "Bacteroidia"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 272559
Genome Sequence(s)
GenBank CR626927.1
EMBL CR626927
Organism Additional Information The Bacteroides constitute the major population of human intestinal microbiota. They are beneficial to the humans in terms of metabolism, development, and immunity. They play roles in recycling of bile acids, provision of short-chain fatty acids to the host and angiogenesis.
Gene Information
Gene NamepepO (BF3918)
NCBI Gene ID 3286398
Protein Information
Protein NameBF3918
UniProtKB/SwissProt ID Q5L8J2
NCBI RefSeq YP_213499.1
EMBL-CDSCAH09595.1
UniProtKB Sequence >tr|Q5L8J2|Q5L8J2_BACFN Putative endopeptidase OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343) GN=pepO PE=4 SV=1 MKVIKYLPILAICCMATGCNSKKEAVLTSGIDLANLDTTALPGTSFYQYACGGWMKNHPL TDEYSRFGSFDMLAENNRQQLRGLIEGLAAEKHEAGSIAQKVGELYNIAMDSVKLNKEGA APIKPELEKIGAIKDKAEIYPLIVEMQKRGMYPYFILYVSADDMNSNENMVHTMQGGLGM GERDYYLEDDAQTKEIRDKYQQHVSKMFQLAGYDEATARKAVKAVMNIETRLAQSARSQV ELRDPHANYNKKTLEELQKEYPSFAWDVFFSTAGLNNLKEVNIGQPDALKEVNAIIDTVS LEDQILYLQWNLINSAANYLSDDFIAQDFDFYGRTMSGKKEMQPRWKRAVSTVDGSLGEA VGQMYVEKYFPAAAKERMVALVKNLQESLGERIKGLSWMGEETKEKALEKLATFHVKIGY PDKWKDYSSLEIKDDSYWANIERANQWSYNEMIGKYGKPVDKDEWYMTPQTVNAYYNPTT NEICFPAGILQYPFFDMNADDAFNYGAIGVVIGHEMTHGFDDQGRQYDKDGNLKDWWTAE DAKNFEARAAVMANFFDSIEVAPGVHANGEFTLGENIADHGGLQVSYQAFKKATAAAPLK IENGFTPEQRFFLSYANVWAGNIRPEEILKRTKTDPHSLGKWRVDGALPQIGAWYEAFNI TEKDPMYLPVDKRVSIW
Sequence length 677 AA
Subcellular LocationOuter membrane - facing periplasm
Function Zinc endopeptidase (M13 family).
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel, AAL (Aleuria aurantia lectin) reactivity, Pro-Q Emerald Glycostaining and reactivity towards anti-glycan antiserum
Glycan Information
Glycan Annotation Exogenous fucose.
Literature
Year of Identification2009
Year of Identification Month Wise2009.4
ReferenceFletcher, C.M., Coyne, M.J., Villa, O.F., Chatzidaki-Livanis, M. and Comstock, L.E. (2009) A general O-glycosylation system important to the physiology of a major human intestinal symbiont. Cell, 137, 321-331. [PubMed: 19379697]
Author Comstock, L.E.
Research GroupChanning Laboratory, Brigham and Womens Hospital, Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115, USA.
Corresponding Author Fletcher, C.M., Coyne, M.J., Bentley, D.L., Villa, O.F. Comstock, L.E.
ContactChanning Laboratory, Brigham and Womens Hospital, Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115, USA.