ProGP319

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP319
Validation Status Uncharacterized
Organism Information
Organism NameBacteroides fragilis(strain ATCC 25285/NCTC 9343)
Domain Bacteria
Classification Family: Bacteroidaceae
Order: "Bacteroidales"
Class: "Bacteroidia"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 272559
Genome Sequence(s)
GenBank CR626927.1
EMBL CR626927
Organism Additional Information The Bacteroides constitute the major population of human intestinal microbiota. They are beneficial to the humans in terms of metabolism, development, and immunity. They play roles in recycling of bile acids, provision of short-chain fatty acids to the host and angiogenesis.
Gene Information
Gene NameBF0935
NCBI Gene ID 3288073
Protein Information
Protein NameBF0935
UniProtKB/SwissProt ID Q5LGR0
NCBI RefSeq YP_210628.1
EMBL-CDSCAH06677.1
UniProtKB Sequence >tr|Q5LGR0|Q5LGR0_BACFN Putative zinc protease OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343) GN=BF0935 PE=3 SV=1 MKHLFRGLLLVAVILCCNFQQAFAQQMPPIPIDKNVRIGKLDNGLTYYIRKNNLPANRAD FYIAQKVGSIQEEENQRGLAHFLEHMCFNGTTHFPGDALKQYLERIGVKFGENLNAYTAI DETVYNISNVPVKTPGAVDSCLLILHDWSNDLTLDPKEIDKERGVINEEWRTRMSAMMRM QEKLLPMMYPGDKYAHSFPIGTMDVVMNFKPQTLRDYYEKWYRPDLQGIVIVGDIDVDAV EAKIKTMFADIPAQPNAAERIYYPVADNKEPIICILKDKEQPHVQVLLFNKHEAVPDNQK GNVDYLIQQYAKNLISIMLNARLNELVQTANPPYIYAGADDSNFFVAKTKDAFLGIVVCK EDSIENGIAAMLRELERARQFGFTETEYNRARAEYLRQLESSYNERDKQKNEKYVNEYVR HFLDNEPIPGIENEYTIINQIAPNIPVAAINQLMKGLITDDNQALALFAPEKEDLKLPSE AAIAKLLKDAKTEKLTAYVDKVSDEPLMAEAPKGGKIVSESKDNIFGATTLTLSNGVKVI IKKTDFKADEIRMKGVSLGGSSVFPDSEIININGLDAVGVGGLGNFSAVNLEKVLAGKKA SVSYDIANKTESVSGSCSPKDFETMMQLTYLTFTAPRRDDDAFASYKNRNKAALKNQELN PNVAFSDSIQAGIYMKHPRIIRIKADMVDQMDYDKILSMYQDRFKDASDFTFIFVGNVDV EKMKPVIAEYLGALPAVNRKETFKDNKIEMRQGIYKNEFTKQQETPKASVFAFYNGDCKY DLRNNLLLSMTSQILDLIYTEKVREDEGGTYGVYVGGTLQKYPKEKAILQIIFDTAPEKK EKLMKIIFGEIDNITKTGPSEANLNKVKEYMLKKHTEDLKENSYWLGSIDEYLYTGMNRM NDYEKIVNSITVNDIRKFADDLFKQKNEVEVTMVSPEKK
Sequence length 939 AA
Subcellular LocationPeriplasm
Function Zinc endopeptidase (M16 family).
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel, AAL (Aleuria aurantia lectin) reactivity, Pro-Q Emerald Glycostaining and reactivity towards anti-glycan antiserum
Glycan Information
Glycan Annotation Exogenous fucose.
Literature
Year of Identification2009
Year of Identification Month Wise2009.4
ReferenceFletcher, C.M., Coyne, M.J., Villa, O.F., Chatzidaki-Livanis, M. and Comstock, L.E. (2009) A general O-glycosylation system important to the physiology of a major human intestinal symbiont. Cell, 137, 321-331. [PubMed: 19379697]
Author Comstock, L.E.
Research GroupChanning Laboratory, Brigham and Womens Hospital, Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115, USA.
Corresponding Author Fletcher, C.M., Coyne, M.J., Bentley, D.L., Villa, O.F. Comstock, L.E.
ContactChanning Laboratory, Brigham and Womens Hospital, Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115, USA.