ProGP343

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP343
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200 (type B strain)
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Sequence(s)
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_0069
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_0069
UniProtKB/SwissProt ID A0A0B3VRI1
NCBI RefSeq WP_010032229.1
EMBL-CDSKIP31309.1
UniProtKB Sequence >tr|A0A0B3VRI1|A0A0B3VRI1_FRATU Uncharacterized protein OS=Francisella tularensis subsp. holarctica GN=CH66_1308 PE=4 SV=1 MRNIFKKTLLILLLSVIIASCGMLSNDQFVYLGHGENSPDYQLYYDKTQKLFVLIDKRNG CFQKDDTGTCLAFTLKQAREFREYVLAKMIEIDVRLAKDDYGNYAIEELRKAGVTTVNKP IKTKKVFATPVKQIVLDRKQQYHLVRKEYEIDSNLVAMVVNDKEGKKRIKVAYTVYFPGL EKEYSTELRPFIIDPEYLYTHMTIDAVHEAQFMQRDVMKSQTNVKKKVDDYLKDVVDSDK KDTGYTHQEVASSVAALDNDLITKADEQREDKETTLASGSSISTIAKKPINQESSGSTIQ TATKTASTTQVDSNDTPKTTLASDNK
Sequence length 326 AA
Subcellular LocationMembrane
Protein Structure
Protein Additional InformationHypothetical protein
Glycosylation Status
Glycosylation Type Not identified but probably O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinNot identified
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionHydrazide labeling and lectin blotting
Glycan Information
Glycan Annotation Hexasaccharideof 1156 Da and identified sequence is X-P-HexNAc-HexNAc-Hex-Hex-HexNAc, where X denotes the unknown monosaccharide containing a phosphate group.
Technique(s) used for Glycan Identification In gel trypsin digestion and nano-scale HPLC coupled on-line with an LTQ-FT-ICR mass spectrometer using a stepped orifice voltage scan
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
Year of Validation 2012
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567
AuthorBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Reference Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik. (2012) Characterization of Protein Glycosylation in Francisella tularensis subsp. holarctica. The American Society for Biochemistry and Molecular Biology
Author Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic.
Corresponding Author Jiri Stulik.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic.