ProGP344

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP344
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Sequence(s)
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_1071
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_1071
UniProtKB/SwissProt ID Q19TM5
NCBI RefSeq WP_003019051.1
EMBL-CDSDQ451146.1
UniProtKB Sequence >tr|Q19TM5|Q19TM5_FRATU Conserved lipoprotein OS=Francisella tularensis subsp. holarctica GN=CH66_691 PE=4 SV=1 MTKKKLLKALAVAAIATSLVACSDSSSNDKTSTTAVSSGSSVATTTVAAPADNTNVTANA SYTIGYGMGSSIATDKNIKTFNFNNDKVMAGFEDAINAKKPAIPLEDIANNMNTLRDKMQ QQMNQKAVTSFLSVQDGIYNSDLTPKSDIKNPDVVVYEFFDYQCMYCSKLAPEIEKIMKD NSDVQVVFAEFPIFGQKLPASEYAAEVSTAIYKLYGADAYVKYHNGIFATGEDEGSLKNA TVDNVAKQAGADMTKVNKAIQDDKIADHLKDMLKMGFGQLGIQGAPFLVIAPAKNATVAN TTIIGGYTTADGIQAAINKAKSTATTTSTSNNGQTDTKHSQNDIATVTAEAQAISGSTEQ LAQQSQDDDSVEA
Sequence length 373 AA
Subcellular LocationMembrane
Function DsbA homologue, putative thioredoxin family protein
Protein Structure
Protein Additional InformationDsbA homologue
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Predicted Glycosites T34, T45, T46, S32, S37 and S41
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionHydrazide labeling and lectin affinity chromatography.
Glycan Information
Glycan Annotation X-P-HexNAc-HexNAc-Hex-Hex-HexNAc, where X denotes the unknown monosaccharide containing a phosphate group
Technique(s) used for Glycan Identification Mass spectrometry
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
Year of Validation 2012
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567
AuthorBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Reference Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik. (2012) Characterization of Protein Glycosylation in Francisella tularensis subsp. holarctica. The American Society for Biochemistry and Molecular Biology
Author Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic.
Corresponding Author Jiri Stulik.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic.