
Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP363
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Sequence(s)
GenBank NC_002163.1. 
EMBL AL111168 
Gene Information
Gene Namecj0168c
NCBI Gene ID 904507. 
GenBank Gene Sequence NC_002163.1. 
Protein Information
Protein NamePutative membrane protein
UniProtKB/SwissProt ID Q0PBX0
NCBI RefSeq WP_010891840.1
UniProtKB Sequence >tr|Q0PBX0|Q0PBX0_CAMJE Putative periplasmic protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj0168c PE=4 SV=1 MKKVVLISALLGAFAANVFAANTPSDVNQTHTKAKADKKHEAKTHKKTKEQTPAQ
Sequence length 55 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN28
Glycosite(s) Annotated Protein Sequence >tr|Q0PBX0|Q0PBX0_CAMJE Putative periplasmic protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj0168c PE=4 SV=1 MKKVVLISALLGAFAANVFAANTPSDVN*(28)QTHTKAKADKKHEAKTHKKTKEQTPAQ
Sequence Around Glycosites (21 AA) VFAANTPSDVNQTHTKAKADK
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS and CID/ETD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011
ReferenceScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (201Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics. 2011 Feb;10(2):M000031-MCP201.
AuthorScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ
Research GroupSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia
Corresponding Author Cordwell SJ
ContactSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia