
Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP364
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Sequence(s)
GenBank NC_002163.1. 
EMBL AL111168 
Gene Information
Gene NamesecG
NCBI Gene ID 904562. 
GenBank Gene Sequence NC_002163.1. 
Protein Information
Protein NameCj0235c (Putative protein export protein)
UniProtKB/SwissProt ID Q0PBR9
NCBI RefSeq WP_002851915.1
Sequence length 123 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN120
Glycosite(s) Annotated Protein Sequence >tr|Q0PBR9|Q0PBR9_CAMJE Uncharacterized protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=secG PE=4 SV=1 MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL LIANTIGLGYLYNKASKDSLAEKIKVENNNTTIPSAPIVPTTPNTNSIAPSAPQLPSDVN*(120) SSK
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011
ReferenceScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (201Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics. 2011 Feb;10(2):M000031-MCP201.
AuthorScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ
Research GroupSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia
Corresponding Author Cordwell SJ
ContactSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia