ProGP367

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP367
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Sequence(s)
GenBank NC_002163.1. 
EMBL AL111168 
Gene Information
Gene NamemreC
NCBI Gene ID 904602. 
GenBank Gene Sequence NC_002163.1. 
Protein Information
Protein NameCj0277 (Rod shape-determining protein)
UniProtKB/SwissProt ID Q0PBM8
NCBI RefSeq WP_002864583.1
EMBL-CDSCAL34431.1.
UniProtKB Sequence >tr|Q0PBM8|Q0PBM8_CAMJE Homolog of E. coli rod shape-determining protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=mreC PE=4 SV=1 MKNKIFYVLVLAFLVFISFYYGGLIKQNVLRVNDFVIGNFYNIKDYLGEKISEHFNQANQ IQQLKARNKELEDIAVKVTSFANQLNRILEDQNSTKYLPQVSLTRVISYVQLNDYKKLWL DWSKIPVGKNRGLIYQGYTAGIAINKNGRAMALLQGDDQCVFSVYIGKSKAPGLIQGEDG RIVVKFIPKWAKINTGDEILTSGLDNIFFSDIPVGIVNRVNDEDMYQSVEVKPYVKISIP AYLYVVDNL
Sequence length 249 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN93
Glycosite(s) Annotated Protein Sequence >tr|Q0PBM8|Q0PBM8_CAMJE Homolog of E. coli rod shape-determining protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=mreC PE=4 SV=1 MKNKIFYVLVLAFLVFISFYYGGLIKQNVLRVNDFVIGNFYNIKDYLGEKISEHFNQANQ IQQLKARNKELEDIAVKVTSFANQLNRILEDQN*(93)STKYLPQVSLTRVISYVQLNDYKKLWL DWSKIPVGKNRGLIYQGYTAGIAINKNGRAMALLQGDDQCVFSVYIGKSKAPGLIQGEDG RIVVKFIPKWAKINTGDEILTSGLDNIFFSDIPVGIVNRVNDEDMYQSVEVKPYVKISIP AYLYVVDNL
Sequence Around Glycosites (21 AA) NQLNRILEDQNSTKYLPQVSL
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS and CID/ETD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
BCSDB ID20059
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011
ReferenceScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (201Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics. 2011 Feb;10(2):M000031-MCP201.
AuthorScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ
Research GroupSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia
Corresponding Author Cordwell SJ
ContactSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia