ProGP408

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP408
Validation Status Uncharacterized
Organism Information
Organism NameShewanella oneidensis MR-1 (ATCC 700550)
Domain Bacteria
Classification Family: Shewanellaceae
Order: Alteromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 211586
Genome Sequence(s)
GenBank AE014299.2
EMBL AE014299.2
Gene Information
Gene NameflaB (SO3237)
GenBank Gene Sequence AE014299.2
Protein Information
Protein NameFlaB (Flagellin)
UniProtKB/SwissProt ID Q8ECA6
NCBI RefSeq NP_718792.1
EMBL-CDSAAN56236.2
UniProtKB Sequence >tr|Q8ECA6|Q8ECA6_SHEON Flagellin OS=Shewanella oneidensis (strain MR-1) GN=fliC PE=3 SV=1 MAITVNTNVTSLKAQKNLNTSASDLATSMERLSSGLRINSAKDDAAGLAISNRLNSQVRG LEVGMRNANDAISIAQIAEGAMQEQTNMLQRMRDLTVQSENGANSSADLSALKAEMDQLA NEIDEIGKTTAFGTTKLLAGGFSAGKNFQVGAQDGEDIKVTVKASNKSSLSVGSLGNTTS AARASSLKKIDAAIKTIDAQRADLGAIQNRLAHNISNSANTQANVADAKSRIVDVDFAKE TSQMTKNQVLQQTGSAMLAQANQLPQVALSLL
Sequence length 272 AA
Subcellular LocationFlaggellum
Function Flagellin FliC, encodes functional filament subunits and helps bacteria in motility
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionAberrant migration on SDS-PAGE
Literature
Year of Identification2011
Year of Identification Month Wise2011.6.22
Reference Wu L, Wang J, Tang P, Chen H, Gao H. (201Genetic and molecular characterization of flagellar assembly in Shewanella oneidensis. PLoS One., 6, e21479.
AuthorWu L, Wang J, Tang P, Chen H, Gao H
Research GroupInstitute of Microbiology and College of Life Sciences, Zhejiang University, Hangzhou, Zhejiang, China.
Corresponding Author Gao H
ContactInstitute of Microbiology and College of Life Sciences, Zhejiang University, Hangzhou, Zhejiang, China.