ProGP413

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP413
Validation Status Characterized
Organism Information
Organism NameBurkholderia pseudomallei K96243
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 272560
Genome Sequence(s)
GenBank NC_006350 and NC_006351
EMBL BX571965.1 and BX571966.1
Organism Additional Information Potential biothreat agent
Gene Information
Gene NameFliC
GenBank Gene Sequence NC_006350.1
Protein Information
Protein NameFliC (Flagellin)
UniProtKB/SwissProt ID H7C7G3
NCBI RefSeq YP_109915.1
EMBL-CDSCAH37332.1
UniProtKB Sequence >tr|H7C7G3|H7C7G3_BURPS Flagellin OS=Burkholderia pseudomallei (strain K96243) GN=fliC PE=3 SV=1 MLGINSNINSLVAQQNLNGSQGALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGL NQGVSNANDGVSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQIS EVNRIASQTNYNGKNILDGSAGTLSFQVGANVGQTVSVDLTQSMSAAKIGGGMVQTGQTL GTIKVAIDSSGAAWSSGSTGQETTQINVVSDGKGGFTFTDQNNQALSSTAVTAVFGSSTA GTGTAASPSFQTLALSTSATSALSATDQANATAMVAQINAVNKPQTVSNLDISTQTGAYQ AMVSIDNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSADFAQETANLS RAQVLQQAGISVLAQANSLPQQVLKLLQ
Sequence length 388 AA
Subcellular LocationFlaggellum
Function Motility
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS198
Glycosite(s) Annotated Protein Sequence >tr|H7C7G3|H7C7G3_BURPS Flagellin OS=Burkholderia pseudomallei (strain K96243) GN=fliC PE=3 SV=1 MLGINSNINSLVAQQNLNGSQGALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGL NQGVSNANDGVSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQIS EVNRIASQTNYNGKNILDGSAGTLSFQVGANVGQTVSVDLTQSMSAAKIGGGMVQTGQTL GTIKVAIDSSGAAWSSGS*(198)TGQETTQINVVSDGKGGFTFTDQNNQALSSTAVTAVFGSSTA GTGTAASPSFQTLALSTSATSALSATDQANATAMVAQINAVNKPQTVSNLDISTQTGAYQ AMVSIDNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSADFAQETANLS RAQVLQQAGISVLAQANSLPQQVLKLLQ
Sequence Around Glycosites (21 AA) DSSGAAWSSGSTGQETTQINV 
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detectionbeta elimination of the Asp-N-digested peptide
Glycan Information
Glycan Annotation Glycan identified to be 291 Da in size and possessing acetamidino group and ammonia.
Technique(s) used for Glycan Identification Trypsin deigestion and MS and MSMS
Literature
Year of Identification2011
Year of Identification Month Wise2011.07
ReferenceScott AE, Twine SM, Fulton KM, Titball RW, Essex-Lopresti AE, Atkins TP, Prior JL. (201Flagellar glycosylation in Burkholderia pseudomallei and Burkholderia thailandensis. J Bacteriol., 193, 3577-87. [PMID: 21602339]
AuthorScott AE, Twine SM, Fulton KM, Titball RW, Essex-Lopresti AE, Atkins TP, Prior JL
Research GroupDefence Science and Technology Laboratory, Porton Down, Salisbury SP4 0JQ, United Kingdom.
Corresponding Author Prior JL
ContactDefence Science and Technology Laboratory, Porton Down, Salisbury SP4 0JQ, United Kingdom.